Dryobates pubescens (Downy woodpecker): 104300834 Help Entry 104300834         CDS       T08526                                  Symbol RAB8A Name (RefSeq) ras-related protein Rab-8A   KO K07901   Ras-related protein Rab-8A Organism dpub  Dryobates pubescens (Downy woodpecker) Pathway dpub04140   Autophagy - animal dpub04144   Endocytosis dpub04530   Tight junction Brite KEGG Orthology (KO) [BR:dpub00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     104300834 (RAB8A)    04140 Autophagy - animal     104300834 (RAB8A)   09144 Cellular community - eukaryotes    04530 Tight junction     104300834 (RAB8A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dpub04131]     104300834 (RAB8A)    03036 Chromosome and associated proteins [BR:dpub03036]     104300834 (RAB8A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dpub04147]     104300834 (RAB8A)    04031 GTP-binding proteins [BR:dpub04031]     104300834 (RAB8A) Membrane trafficking [BR:dpub04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     104300834 (RAB8A)  Autophagy   Other autophagy associated proteins     104300834 (RAB8A) Chromosome and associated proteins [BR:dpub03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     104300834 (RAB8A) Exosome [BR:dpub04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104300834 (RAB8A)   Exosomal proteins of other body fluids (saliva and urine)    104300834 (RAB8A)   Exosomal proteins of colorectal cancer cells    104300834 (RAB8A) GTP-binding proteins [BR:dpub04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     104300834 (RAB8A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA DUF3963 Motif Other DBs NCBI-GeneID:  104300834 NCBI-ProteinID:  XP_009899460 LinkDB All DBs Position Unknown AA seq 174 aa AA seqDB search MGPDTSQWCIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNE KSFENIRNWVRNIEEHASPDVEKMILGNKCDANDKRQVSREQGEKLAASFGIKFMETSAK ANINIENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKKSSFFRCVLL NT seq 525 nt NT seq  +upstreamnt  +downstreamnt atggggccagatacttcacagtggtgtattgattttaaaattaggactatagagctggac ggcaagagaattaaactgcagatatgggacacggcagggcaggagcggttccggaccatc accactgcctactaccggggagccatgggcattatgttagtctatgacatcaccaatgaa aaatcctttgaaaatattcggaactgggtcaggaatattgaagagcacgcctcaccagac gtggagaaaatgattctggggaacaaatgtgatgcaaacgacaaaagacaggtttctaga gagcaaggggagaagcttgctgccagttttgggattaaatttatggagaccagtgcaaaa gcaaacataaacatagagaatgcatttttcacccttgccagagatatcaaagcaaaaatg gacaagaagttggaaggcaacagcccccaaggcagcaaccagggagtcaaaatcacacca gaccagcaaaagaaaagcagcttcttccgttgtgttcttctgtga

DBGET integrated database retrieval system