Dryobates pubescens (Downy woodpecker): 104301961 Help Entry 104301961         CDS       T08526                                  Symbol PFN2 Name (RefSeq) profilin-2   KO K05759   profilin Organism dpub  Dryobates pubescens (Downy woodpecker) Pathway dpub04810   Regulation of actin cytoskeleton dpub05132   Salmonella infection Brite KEGG Orthology (KO) [BR:dpub00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     104301961 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     104301961 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dpub04131]     104301961 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:dpub04812]     104301961 (PFN2)    04147 Exosome [BR:dpub04147]     104301961 (PFN2) Membrane trafficking [BR:dpub04131]  Others   Actin-binding proteins    Others     104301961 (PFN2) Cytoskeleton proteins [BR:dpub04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      104301961 (PFN2) Exosome [BR:dpub04147]  Exosomal proteins   Proteins found in most exosomes    104301961 (PFN2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  104301961 NCBI-ProteinID:  XP_009900723 LinkDB All DBs Position Unknown AA seq 109 aa AA seqDB search MRPVASALISRGQPVEIDMIVGKDREGFFTNGLTLGAKKCSVIRDSLYVDGDCTMDIRTK SQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF NT seq 330 nt NT seq  +upstreamnt  +downstreamnt atgcggccggtggcatctgcgctgatctctcggggacagccagtagaaatagatatgatt gtaggaaaagaccgagagggttttttcaccaatggcctgacccttggtgcaaagaagtgc tctgtgatcagagatagcctgtacgtggatggtgactgcacaatggacatcaggacaaag agtcaaggtggtgagccgacgtacaatgttgctgtaggcagagctggccgagtcttggtc tttgtaatgggcaaagaaggggtccatggaggcggcttgaataagaaggcatactcaatg gcaaaatacttgagagactctgggttctag

DBGET integrated database retrieval system