Dryobates pubescens (Downy woodpecker): 104302016 Help Entry 104302016         CDS       T08526                                  Symbol DNAL4 Name (RefSeq) dynein light chain 4, axonemal   KO K10412   dynein axonemal light chain 4 Organism dpub  Dryobates pubescens (Downy woodpecker) Pathway dpub04814   Motor proteins Brite KEGG Orthology (KO) [BR:dpub00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     104302016 (DNAL4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:dpub03037]     104302016 (DNAL4)    04812 Cytoskeleton proteins [BR:dpub04812]     104302016 (DNAL4) Cilium and associated proteins [BR:dpub03037]  Motile cilia and associated proteins   Dynein arm    104302016 (DNAL4) Cytoskeleton proteins [BR:dpub04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      104302016 (DNAL4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light GARS_A DUF6935 Motif Other DBs NCBI-GeneID:  104302016 NCBI-ProteinID:  XP_009900783 UniProt:  A0A093GI43 LinkDB All DBs Position Unknown AA seq 106 aa AA seqDB search MADTGEGKKEEADYKRLHSFPLIRHTDMPEEMRVEAMELCVTACEKYATNNESAAKMIKE MMDKKFGSSWHVVIGESFGFEITHEMKNLLYMFFGGSLAVCVWKCS NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atggcagacaccggggaggggaaaaaggaggaggctgattataaaagacttcacagcttt ccactgatcaggcacacggacatgccagaggagatgcgtgtggaggccatggagctgtgt gtcacagcatgtgagaaatacgccaccaacaacgagagcgctgccaagatgatcaaagag atgatggacaagaagtttgggtcctcctggcatgtggtgattggggaaagctttggcttt gagatcactcatgagatgaagaatctgctgtacatgttcttcggtggcagcctggccgtg tgcgtctggaagtgctcctga

DBGET integrated database retrieval system