Dryobates pubescens (Downy woodpecker): 104303055 Help Entry 104303055         CDS       T08526                                  Symbol DEFB1 Name (RefSeq) beta-defensin 1   KO K23125   beta-defensin 1 Organism dpub  Dryobates pubescens (Downy woodpecker) Pathway dpub02010   ABC transporters Brite KEGG Orthology (KO) [BR:dpub00001]  09130 Environmental Information Processing   09131 Membrane transport    02010 ABC transporters     104303055 (DEFB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:dpub02000]     104303055 (DEFB1)    03037 Cilium and associated proteins [BR:dpub03037]     104303055 (DEFB1) Transporters [BR:dpub02000]  Other transporters   Pores ion channels [TC:1]    104303055 (DEFB1) Cilium and associated proteins [BR:dpub03037]  Motile cilia and associated proteins   Sperm associated proteins    104303055 (DEFB1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Defensin_beta Motif Other DBs NCBI-GeneID:  104303055 NCBI-ProteinID:  XP_009901932 LinkDB All DBs Position Unknown AA seq 65 aa AA seqDB search MSSKATKTLFLLLLLLPMVSQAAAEADTVVCRKTRGECAFILCPLFKRATGTCYNGLAKC CRPLW NT seq 198 nt NT seq  +upstreamnt  +downstreamnt atgtcatccaaagccacaaagacactcttccttcttcttcttctcctccccatggtgtcc caggctgctgcagaggcagacactgtggtgtgccggaagaccaggggcgagtgtgcgttc atactgtgtcccttgtttaagagagccaccggtacctgctacaacggactggcaaagtgc tgcaggcccttgtggtga

DBGET integrated database retrieval system