Dryobates pubescens (Downy woodpecker): 104303313 Help Entry 104303313         CDS       T08526                                  Symbol CALML4 Name (RefSeq) calmodulin-like protein 4   KO K02183   calmodulin Organism dpub  Dryobates pubescens (Downy woodpecker) Pathway dpub04020   Calcium signaling pathway dpub04070   Phosphatidylinositol signaling system dpub04114   Oocyte meiosis dpub04218   Cellular senescence dpub04261   Adrenergic signaling in cardiomyocytes dpub04270   Vascular smooth muscle contraction dpub04371   Apelin signaling pathway dpub04625   C-type lectin receptor signaling pathway dpub04744   Phototransduction dpub04910   Insulin signaling pathway dpub04912   GnRH signaling pathway dpub04916   Melanogenesis Brite KEGG Orthology (KO) [BR:dpub00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     104303313 (CALML4)    04020 Calcium signaling pathway     104303313 (CALML4)    04070 Phosphatidylinositol signaling system     104303313 (CALML4)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     104303313 (CALML4)    04218 Cellular senescence     104303313 (CALML4)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     104303313 (CALML4)   09152 Endocrine system    04910 Insulin signaling pathway     104303313 (CALML4)    04912 GnRH signaling pathway     104303313 (CALML4)    04916 Melanogenesis     104303313 (CALML4)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     104303313 (CALML4)    04270 Vascular smooth muscle contraction     104303313 (CALML4)   09157 Sensory system    04744 Phototransduction     104303313 (CALML4)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:dpub01009]     104303313 (CALML4)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dpub04131]     104303313 (CALML4)    03036 Chromosome and associated proteins [BR:dpub03036]     104303313 (CALML4)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dpub04147]     104303313 (CALML4) Protein phosphatases and associated proteins [BR:dpub01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      104303313 (CALML4) Membrane trafficking [BR:dpub04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     104303313 (CALML4) Chromosome and associated proteins [BR:dpub03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      104303313 (CALML4) Exosome [BR:dpub04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    104303313 (CALML4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_9 EF-hand_6 EF-hand_8 AIF-1 EF-hand_1 EF-hand_11 GPHH Motif Other DBs NCBI-GeneID:  104303313 NCBI-ProteinID:  XP_009902231 LinkDB All DBs Position Unknown AA seq 210 aa AA seqDB search MVTSENSDLGDPKPPPVSPRVTSENSDLGDPKPPPVSPRVTSENSDLGDPKPPPVSPMAK FLSQDQINEFKECFSLYDKKQKGKIKASDLMVVMRCLGASPTPGEVQRHLHLHKIDRNAE LDFSTFLNIMYRQMKQEEPESEILTALSMIDRQKEGVIAVSELRAKLTRLGEKLSEEEVD DLLKEAKVGPKGTIKYEEFVRSICLPPADY NT seq 633 nt NT seq  +upstreamnt  +downstreamnt atggtaaccagtgaaaactcagacctgggggatcccaaacccccaccagtgtccccaagg gtaaccagtgaaaactcagacctgggggatcccaaacccccaccagtgtccccaagggta accagtgaaaactcagacctgggggatcccaaacccccaccagtgtccccaatggcaaaa tttctgtcccaggatcaaattaatgagttcaaggaatgtttctccctctacgacaagaaa caaaaagggaagatcaaagcctctgacctgatggtagtgatgaggtgcctgggagccagc ccaacgccaggagaggtgcagaggcacctgcacttgcacaagatcgacaggaatgcagag ttggatttctccacgttcctcaacatcatgtacaggcagatgaagcaggaggagcctgag agcgagatcctcacggcgttgtccatgatagacaggcagaaggaaggtgtcatcgcggtt tccgagctgagagctaaactcaccagactaggagaaaagctttctgaggaagaagttgat gacctgctgaaagaagccaaagtgggaccaaagggaacgatcaaatatgaagagtttgtc cgcagcatttgtcttcctcctgctgactactaa

DBGET integrated database retrieval system