Dryobates pubescens (Downy woodpecker): 104304428 Help Entry 104304428         CDS       T08526                                  Symbol RRAS2 Name (RefSeq) ras-related protein R-Ras2   KO K07830   Ras-related protein R-Ras2 Organism dpub  Dryobates pubescens (Downy woodpecker) Pathway dpub04010   MAPK signaling pathway dpub04137   Mitophagy - animal dpub04140   Autophagy - animal dpub04218   Cellular senescence dpub04371   Apelin signaling pathway dpub04625   C-type lectin receptor signaling pathway dpub04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:dpub00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104304428 (RRAS2)    04371 Apelin signaling pathway     104304428 (RRAS2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     104304428 (RRAS2)    04137 Mitophagy - animal     104304428 (RRAS2)   09143 Cell growth and death    04218 Cellular senescence     104304428 (RRAS2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     104304428 (RRAS2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     104304428 (RRAS2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dpub04147]     104304428 (RRAS2)    04031 GTP-binding proteins [BR:dpub04031]     104304428 (RRAS2) Exosome [BR:dpub04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    104304428 (RRAS2)   Exosomal proteins of bladder cancer cells    104304428 (RRAS2) GTP-binding proteins [BR:dpub04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     104304428 (RRAS2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf ATP_bind_1 MMR_HSR1 Motif Other DBs NCBI-GeneID:  104304428 NCBI-ProteinID:  XP_009903470 LinkDB All DBs Position Unknown AA seq 183 aa AA seqDB search MTSVNLTSPCLCFLQSYFVTDYDPTIEDSYTKQCVIDERAARLDILDTAGQEEFGAMREQ YMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILVGNKADLDHQRQVTQEE GQQLARQLKVTYMEASAKIRLNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHC VIF NT seq 552 nt NT seq  +upstreamnt  +downstreamnt atgacatctgttaacttgacttcaccttgtctttgtttcctgcagtcctatttcgttacg gattatgatccaacgatcgaagactcctacaccaagcagtgcgtgatagacgagcgagcg gcgcgcttggacattctggatacagcaggacaagaagaatttggagccatgcgtgagcag tacatgaggacaggggagggttttctgctcgttttctcagtgactgatagaggaagtttt gaagagatctataagtttcagcgacagattcttagagtgaaagatcgtgatgagttccct atgattctagttggtaataaagcagatctggaccaccaaagacaggtgacgcaagaggaa ggtcagcagctagcacggcaacttaaagtcacatacatggaagcctcagcaaaaatcaga ttgaatgtagaccaagcttttcatgaacttgtcagagttataagaaaatttcaagaacaa gagtgccctccttcaccagaacccacacggaaagagaaagacaagaaaggctgccattgt gttattttctga

DBGET integrated database retrieval system