Dryobates pubescens (Downy woodpecker): 104305807 Help Entry 104305807         CDS       T08526                                  Symbol INS Name (RefSeq) insulin   KO K04526   insulin Organism dpub  Dryobates pubescens (Downy woodpecker) Pathway dpub04010   MAPK signaling pathway dpub04068   FoxO signaling pathway dpub04081   Hormone signaling dpub04114   Oocyte meiosis dpub04140   Autophagy - animal dpub04150   mTOR signaling pathway dpub04810   Regulation of actin cytoskeleton dpub04910   Insulin signaling pathway dpub04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:dpub00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     104305807 (INS)    04150 mTOR signaling pathway     104305807 (INS)   09133 Signaling molecules and interaction    04081 Hormone signaling     104305807 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     104305807 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dpub04052]     104305807 (INS) Cytokines and neuropeptides [BR:dpub04052]  Neuropeptides   Unclassified    104305807 (INS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  104305807 NCBI-ProteinID:  XP_009905017 UniProt:  A0A093GS49 LinkDB All DBs Position Unknown AA seq 107 aa AA seqDB search MALWIRSLPLLALLALSSPGTSQAAATQHLCGSHLVEALYLVCGERGFFYYPKARRDIEQ PLVSGPLHGEAGELPFQQAEFEQVKRGIVEQCCHNTCSLYQLENYCN NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggctctctggatccgatcgctgcctctcctggcccttctcgccctttccagccccggg accagccaggcagctgccacccagcacctctgtggctcccacttggtggaagctctctac ctggtgtgtggagagagaggtttcttctactaccccaaagcccgccgggacatcgagcag cctttagtgagtggtcccttgcatggggaggcaggagagctgcccttccagcaggcagag tttgagcaagtgaagcgagggatcgttgagcaatgctgccacaacacctgctccctctac cagctggagaactactgcaactag

DBGET integrated database retrieval system