Dryobates pubescens (Downy woodpecker): 104305922 Help Entry 104305922         CDS       T08526                                  Symbol APITD1 Name (RefSeq) centromere protein S   KO K11511   centromere protein S Organism dpub  Dryobates pubescens (Downy woodpecker) Pathway dpub03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:dpub00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     104305922 (APITD1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:dpub03036]     104305922 (APITD1)    03400 DNA repair and recombination proteins [BR:dpub03400]     104305922 (APITD1) Chromosome and associated proteins [BR:dpub03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      104305922 (APITD1) DNA repair and recombination proteins [BR:dpub03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      104305922 (APITD1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-S CENP-T_C Histone TFIID-31kDa DUF3381 Bromo_TP TAF Motif Other DBs NCBI-GeneID:  104305922 NCBI-ProteinID:  XP_009905142 LinkDB All DBs Position Unknown AA seq 142 aa AA seqDB search MSVCRELTWHCLGSFQRLKAAVHYTVGCLCQDVAEDKGMQFSKQTIAAISEITFRQCETF AKDLEMFARHAKRSTVTTEDVKLLARRSNSLLKYITQKSDELAASTMEQKEKKKKKSSAG KGRRTSEEQGAAVPESEDSNMA NT seq 429 nt NT seq  +upstreamnt  +downstreamnt atgtcagtgtgcagagaactgacctggcactgccttggatccttccagaggctgaaggct gcggtgcactacacggttggctgcctgtgtcaggatgtggcagaagacaaaggcatgcag ttcagcaagcaaaccatcgcagccatttcggagatcaccttcaggcagtgtgagaccttt gcaaaagacctcgaaatgtttgcaaggcatgcaaagcggagcacagtcactacagaggac gtgaagcttttggctagacggagcaactctttgctaaagtatatcacccagaagagtgac gagcttgcagcaagtaccatggagcaaaaggaaaagaagaaaaagaagtccagtgcaggt aaaggaaggagaacttctgaggaacaaggagcagctgtgcctgaaagtgaagattccaac atggcatga

DBGET integrated database retrieval system