Dryobates pubescens (Downy woodpecker): 104306656 Help Entry 104306656         CDS       T08526                                  Symbol RHOA Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism dpub  Dryobates pubescens (Downy woodpecker) Pathway dpub04081   Hormone signaling dpub04144   Endocytosis dpub04150   mTOR signaling pathway dpub04270   Vascular smooth muscle contraction dpub04310   Wnt signaling pathway dpub04350   TGF-beta signaling pathway dpub04510   Focal adhesion dpub04517   IgSF CAM signaling dpub04519   Cadherin signaling dpub04520   Adherens junction dpub04530   Tight junction dpub04621   NOD-like receptor signaling pathway dpub04625   C-type lectin receptor signaling pathway dpub04810   Regulation of actin cytoskeleton dpub05100   Bacterial invasion of epithelial cells dpub05132   Salmonella infection Brite KEGG Orthology (KO) [BR:dpub00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     104306656 (RHOA)    04350 TGF-beta signaling pathway     104306656 (RHOA)    04150 mTOR signaling pathway     104306656 (RHOA)   09133 Signaling molecules and interaction    04081 Hormone signaling     104306656 (RHOA)    04517 IgSF CAM signaling     104306656 (RHOA)    04519 Cadherin signaling     104306656 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     104306656 (RHOA)   09144 Cellular community - eukaryotes    04510 Focal adhesion     104306656 (RHOA)    04520 Adherens junction     104306656 (RHOA)    04530 Tight junction     104306656 (RHOA)   09142 Cell motility    04810 Regulation of actin cytoskeleton     104306656 (RHOA)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     104306656 (RHOA)    04625 C-type lectin receptor signaling pathway     104306656 (RHOA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     104306656 (RHOA)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     104306656 (RHOA)    05100 Bacterial invasion of epithelial cells     104306656 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dpub04131]     104306656 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dpub04147]     104306656 (RHOA)    04031 GTP-binding proteins [BR:dpub04031]     104306656 (RHOA) Membrane trafficking [BR:dpub04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     104306656 (RHOA) Exosome [BR:dpub04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104306656 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    104306656 (RHOA)   Exosomal proteins of colorectal cancer cells    104306656 (RHOA)   Exosomal proteins of bladder cancer cells    104306656 (RHOA) GTP-binding proteins [BR:dpub04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     104306656 (RHOA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  104306656 NCBI-ProteinID:  XP_009905947 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcagccattcgaaaaaagctggttatagtgggtgatggtgcctgtgggaagacctgt ctgctgattgtatttagcaaagaccagttccctgaagtgtatgtccccaccgtcttcgaa aattatgtagcagatattgaagtggatggaaagcaggtggagttggctttgtgggataca gcaggacaagaagactacgatcgacttagaccactttcttatccagataccgatgttata cttatgtgtttttcaattgatagtcctgatagtttagaaaacatcccagagaagtggacc ccagaggtgaagcatttctgccccaacgtgcctatcatcttggtaggaaacaagaaggac ctgaggaatgacgagcacacaagacgagagctggccaaaatgaagcaggagcctgtcaaa cccgaagaaggaagagatatggcaaaccgcatcggtgcttttgggtacatggagtgctcg gcaaagaccaaagacggtgtgagggaggtttttgaaatggccactagagctgctttgcaa gcccggcgtggcaagaaaaagtccgggtgccttctcttataa

DBGET integrated database retrieval system