Daphnia pulex (common water flea): AAD33239 Help Entry AAD33239          CDS       T04347                                  Symbol ND4L Name (GenBank) NADH dehydrogenase subunit 4L   KO K03882   NADH-ubiquinone oxidoreductase chain 4L [EC:7.1.1.2] Organism dpx  Daphnia pulex (common water flea) Pathway dpx00190   Oxidative phosphorylation dpx01100   Metabolic pathways Module dpx_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:dpx00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     AAD33239 (ND4L)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:dpx03029]     AAD33239 (ND4L) Enzymes [BR:dpx01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      AAD33239 (ND4L) Mitochondrial biogenesis [BR:dpx03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     AAD33239 (ND4L) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Oxidored_q2 Motif Other DBs NCBI-ProteinID:  AAD33239 UniProt:  Q9XLS0 LinkDB All DBs AA seq 91 aa AA seqDB search MVLLMGSMLIFLFSFISKRKHLLATLLSLEGLMLMIFGVLFWVSSMVSFSNFVLIFLTLT ACEGALGLSLLVSLVRTHGGDNFNSLNALQC NT seq 276 nt NT seq  +upstreamnt  +downstreamnt attgttttattaatagggtccatattaatttttctttttagatttatttctaaacgtaag catcttctggctactttacttagtttagagggtttgatgcttatgatttttggtgttctt ttttgggtgagatctatggtgagttttagaaattttgttctaatttttttgactcttaca gcttgcgagggagctttagggctctcactattagtttcactggtccgaacccatggcgga gacaactttaactctttaaacgcgctacagtgttaa

DBGET integrated database retrieval system