Daphnia pulex (common water flea): DAPPUDRAFT_189533 Help Entry DAPPUDRAFT_189533 CDS       T04347                                  Name (GenBank) hypothetical protein   KO K11253   histone H3 Organism dpx  Daphnia pulex (common water flea) Brite KEGG Orthology (KO) [BR:dpx00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:dpx03036]     DAPPUDRAFT_189533   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dpx04147]     DAPPUDRAFT_189533 Chromosome and associated proteins [BR:dpx03036]  Eukaryotic type   Nucleosome assembly factors    Histones     DAPPUDRAFT_189533 Exosome [BR:dpx04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    DAPPUDRAFT_189533 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C CENP-S CBFD_NFYB_HMF THSD1_D2 Motif Other DBs NCBI-ProteinID:  EFX67395 JGI:  Dappu1_189533 UniProt:  E9HLL8 LinkDB All DBs Position Unknown AA seq 73 aa AA seqDB search MIQKRVRFQRLVREISKDFKLNLRFQSGAIGTLQEASEAFLVGLFEDTNLCALHASRVTI MPKDIQLARRIRG NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgattcaaaagcgagtgcgtttccaacgacttgttcgcgaaatctcgaaggacttcaaa ctgaacttgagattccagagtggagccattggcaccttgcaagaggccagcgaggccttt ttggtgggcctatttgaagacaccaatctgtgtgctcttcatgccagtcgtgtcaccatc atgcccaaggatattcagctagcacgtcgcatacgaggatag

DBGET integrated database retrieval system