Daphnia pulex (common water flea): DAPPUDRAFT_230556 Help Entry DAPPUDRAFT_230556 CDS       T04347                                  Name (GenBank) hypothetical protein   KO K03008   DNA-directed RNA polymerase II subunit RPB11 Organism dpx  Daphnia pulex (common water flea) Pathway dpx03020   RNA polymerase dpx03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:dpx00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     DAPPUDRAFT_230556   09124 Replication and repair    03420 Nucleotide excision repair     DAPPUDRAFT_230556  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:dpx03021]     DAPPUDRAFT_230556    03400 DNA repair and recombination proteins [BR:dpx03400]     DAPPUDRAFT_230556 Transcription machinery [BR:dpx03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Core subunits      DAPPUDRAFT_230556 DNA repair and recombination proteins [BR:dpx03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       DAPPUDRAFT_230556 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_L_2 RNA_pol_L SHNi-TPR Motif Other DBs NCBI-ProteinID:  EFX85388 JGI:  Dappu1_230556 UniProt:  E9G4Z9 LinkDB All DBs Position Unknown AA seq 117 aa AA seqDB search MNAPPSFESFLLFEGEKKIIVEQDTKVPNAAIFTVNKEDHTLGNMIRCQLLKDPNVLFAG YKQPHPLEHKFILRIQSTPAYSPHDALMNAITDLISELSLLEERFRDAVREKREGLE NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atgaacgcaccaccgtcattcgaatcctttcttttgtttgaaggagagaaaaaaatcatc gttgaacaggacactaaagttcccaacgcagctatcttcaccgtaaacaaggaagatcat actctgggaaacatgattcgctgccagcttctgaaagatcccaatgtgctatttgctgga tacaaacaaccacatccattggagcataaattcattctacgtattcagagtacacctgcc tattctcctcatgatgcgttgatgaatgccatcacagatttgatttcagagctgtcactt cttgaagaacgattccgcgatgccgtacgagaaaagcgagaaggcttagaatag

DBGET integrated database retrieval system