Daphnia pulex (common water flea): DAPPUDRAFT_234554 Help Entry DAPPUDRAFT_234554 CDS       T04347                                  Symbol DpGSTM1 Name (GenBank) hypothetical protein   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism dpx  Daphnia pulex (common water flea) Pathway dpx00480   Glutathione metabolism dpx00980   Metabolism of xenobiotics by cytochrome P450 dpx00982   Drug metabolism - cytochrome P450 dpx00983   Drug metabolism - other enzymes dpx01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:dpx00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     DAPPUDRAFT_234554 (DpGSTM1)   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     DAPPUDRAFT_234554 (DpGSTM1)    00982 Drug metabolism - cytochrome P450     DAPPUDRAFT_234554 (DpGSTM1)    00983 Drug metabolism - other enzymes     DAPPUDRAFT_234554 (DpGSTM1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:dpx02000]     DAPPUDRAFT_234554 (DpGSTM1) Enzymes [BR:dpx01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      DAPPUDRAFT_234554 (DpGSTM1) Transporters [BR:dpx02000]  Other transporters   Pores ion channels [TC:1]    DAPPUDRAFT_234554 (DpGSTM1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GST_N GST_C_3 GST_C GST_C_6 GST_N_2 Motif Other DBs NCBI-ProteinID:  EFX88366 JGI:  Dappu1_234554 UniProt:  E9FWW3 LinkDB All DBs Position Unknown AA seq 176 aa AA seqDB search MAVKTGYWNLRGYMQPIRLLLAYAGVEYEDKRYNIGPAPDYERSEWLNDKFNLGLDFPNV GYCPYYIDGDVKLSQTFAILKYLGRKNNMAARTEEEQIRVDLIEAEAIDMRIRWSTLCYN ADFEKMKPDYIKNVAVKLKEVSTFLGSHPYFAGQNITYIDFVMYELLDQNSDSGDT NT seq 531 nt NT seq  +upstreamnt  +downstreamnt atggctgtcaaaactggttattggaatcttcgtgggtacatgcaacccattcgacttctt ttggcctatgctggggttgagtatgaggacaagcgttataatattggaccggctcccgat tatgaaaggagtgaatggttgaacgacaagtttaaccttggtctggattttccaaatgta ggctactgcccttactacattgatggagatgtgaagctttcacaaacttttgccattctg aaatatttgggacgcaagaataacatggcagccaggactgaggaggagcaaatcagagtg gacttgatagaggcagaagccatcgatatgcgtataaggtggtccacactgtgctataat gccgattttgagaagatgaaaccagattacattaaaaatgttgcagtcaagttgaaggaa gtttccacctttctgggaagtcatccatattttgcaggacagaatattacctacattgat tttgtaatgtatgagttattggaccagaactctgattccggggatacttga

DBGET integrated database retrieval system