Daphnia pulex (common water flea): DAPPUDRAFT_28711 Help Entry DAPPUDRAFT_28711  CDS       T04347                                  Name (GenBank) hypothetical protein   KO K13505   vesicle-associated membrane protein 3 Organism dpx  Daphnia pulex (common water flea) Pathway dpx04130   SNARE interactions in vesicular transport dpx04145   Phagosome Brite KEGG Orthology (KO) [BR:dpx00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04130 SNARE interactions in vesicular transport     DAPPUDRAFT_28711  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     DAPPUDRAFT_28711  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dpx04131]     DAPPUDRAFT_28711 Membrane trafficking [BR:dpx04131]  SNARE   VAMP, Ykt6, Sec22 (R)    VAMP     DAPPUDRAFT_28711 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Synaptobrevin DnaJ-X TMCO5 CspB_prodomain DUF6889 Motif Other DBs NCBI-ProteinID:  EFX71671 JGI:  Dappu1_28711 UniProt:  E9H9D9 LinkDB All DBs Position Unknown AA seq 85 aa AA seqDB search RINSRQLDILHGQMDDVLNVMKENTKRVLDRGHRLHELSERAEALEQQATIFVKSATQVK KKAKFRAAKWTLILAGFVVIFIAVI NT seq 255 nt NT seq  +upstreamnt  +downstreamnt cgaattaattcccgccagttggatatactgcatggccagatggatgacgtgctcaacgtt atgaaggaaaacaccaaacgcgtcttagatcgtggccaccggctccacgaactatccgag cgggctgaagcgctggaacagcaggcgaccatcttcgtcaagtccgccactcaagtcaag aagaaggccaagttcagggctgctaaatggaccttgatcttggccggattcgtcgtcatc tttattgcggtgatc

DBGET integrated database retrieval system