Daphnia pulex (common water flea): DAPPUDRAFT_304485 Help Entry DAPPUDRAFT_304485 CDS       T04347                                  Name (GenBank) hypothetical protein   KO K14965   protein dpy-30 Organism dpx  Daphnia pulex (common water flea) Brite KEGG Orthology (KO) [BR:dpx00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:dpx03036]     DAPPUDRAFT_304485 Chromosome and associated proteins [BR:dpx03036]  Eukaryotic type   Histone modification proteins    HMT complexes     COMPASS/SET1 complex      DAPPUDRAFT_304485     MLL-HCF complex      DAPPUDRAFT_304485     MLL3/MLL4 complex      DAPPUDRAFT_304485 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dpy-30 RIIa Motif Other DBs NCBI-ProteinID:  EFX79530 JGI:  Dappu1_304485 UniProt:  E9GLL2 LinkDB All DBs Position Unknown AA seq 85 aa AA seqDB search MPTSDKDNGEAGQSKKARVDHQTMPTRQYLDQAVVPVVLQAMSAVAKERPADPLEFIANY LLKEAKNRSTQTSETAAQAIPSASA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgccgacttccgataaagacaacggagaagcgggccaatcgaagaaagcacgagtagat catcaaactatgccaactagacagtatttggatcaagccgtagttcccgttgtcttacaa gctatgtctgctgtggctaaagaaagaccagcagaccccctagaatttattgcaaattat ttattgaaggaagcaaaaaatcgatcaacccagacttctgaaacagccgctcaggccata ccctcagcaagcgcttga

DBGET integrated database retrieval system