Daphnia pulex (common water flea): DAPPUDRAFT_318274 Help Entry DAPPUDRAFT_318274 CDS       T04347                                  Name (GenBank) hypothetical protein   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism dpx  Daphnia pulex (common water flea) Pathway dpx04145   Phagosome dpx04148   Efferocytosis dpx04310   Wnt signaling pathway dpx04620   Toll-like receptor signaling pathway dpx05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:dpx00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     DAPPUDRAFT_318274  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     DAPPUDRAFT_318274    04148 Efferocytosis     DAPPUDRAFT_318274  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     DAPPUDRAFT_318274  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     DAPPUDRAFT_318274  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dpx04131]     DAPPUDRAFT_318274   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dpx04147]     DAPPUDRAFT_318274    04031 GTP-binding proteins [BR:dpx04031]     DAPPUDRAFT_318274 Membrane trafficking [BR:dpx04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     DAPPUDRAFT_318274  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     DAPPUDRAFT_318274   Macropinocytosis    Ras GTPases     DAPPUDRAFT_318274  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     DAPPUDRAFT_318274 Exosome [BR:dpx04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    DAPPUDRAFT_318274   Exosomal proteins of other body fluids (saliva and urine)    DAPPUDRAFT_318274   Exosomal proteins of colorectal cancer cells    DAPPUDRAFT_318274   Exosomal proteins of bladder cancer cells    DAPPUDRAFT_318274 GTP-binding proteins [BR:dpx04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     DAPPUDRAFT_318274 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-ProteinID:  EFX80649 JGI:  Dappu1_318274 UniProt:  E9GIB6 LinkDB All DBs Position Unknown AA seq 184 aa AA seqDB search MNRIRPLKITVVGDGMVGKTCILIVYTKKEFPEIHVPTVFDNFSDTIEVDGFPYNVTLWD TAGQEEYKNLRILSYPNTDVFLLCYAVNIRSTFENIITKWIPELKHYCPHTSIVLVGTKV DIRQEGQSNCVSTTEGRELSKKFQLNSFLECSAKTQENVIQVFEEATRVALNKPKSKPHK CSLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgaatagaatccggcctttaaagataaccgtagtcggagacggtatggtgggaaaaacg tgcattctcattgtgtacacgaagaaagaatttccagaaatacatgttccgactgtattt gacaacttttctgatacaattgaagtggatggatttccgtacaatgttacactctgggac actgccggccaggaagaatacaaaaaccttcgcattctttcctatcctaacacggacgtt ttcctactttgctatgccgtcaacatacggtcaacttttgaaaacattatcaccaaatgg atccctgaattgaagcattattgccctcacacatccatagtacttgttggtacaaaagta gatatccggcaagaagggcaatcaaattgcgtatctaccactgagggtcgagaacttagc aagaaatttcaactcaacagttttctggagtgttcggcgaagacgcaagagaatgtaata caagttttcgaagaagccactcgagtcgctctgaataaaccgaaatctaaaccgcacaag tgtagccttctttag

DBGET integrated database retrieval system