Daphnia pulex (common water flea): DAPPUDRAFT_327432 Help Entry DAPPUDRAFT_327432 CDS       T04347                                  Name (GenBank) hypothetical protein   KO K10881   26 proteasome complex subunit DSS1 Organism dpx  Daphnia pulex (common water flea) Pathway dpx03050   Proteasome dpx03440   Homologous recombination Brite KEGG Orthology (KO) [BR:dpx00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     DAPPUDRAFT_327432   09124 Replication and repair    03440 Homologous recombination     DAPPUDRAFT_327432  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:dpx03019]     DAPPUDRAFT_327432    04131 Membrane trafficking [BR:dpx04131]     DAPPUDRAFT_327432    03051 Proteasome [BR:dpx03051]     DAPPUDRAFT_327432    03400 DNA repair and recombination proteins [BR:dpx03400]     DAPPUDRAFT_327432 Messenger RNA biogenesis [BR:dpx03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     TREX-2 complex      DAPPUDRAFT_327432 Membrane trafficking [BR:dpx04131]  Exocytosis   Tethering complex    Exocyst complex assembly proteins     DAPPUDRAFT_327432 Proteasome [BR:dpx03051]  Eukaryotic proteasome   Regulatory particles    PA700 (19S proteasome)     non-ATPase subunits      DAPPUDRAFT_327432 DNA repair and recombination proteins [BR:dpx03400]  Eukaryotic type   DSBR (double strand breaks repair)    HR (homologous recombination)     Other HR factors      DAPPUDRAFT_327432 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DSS1_SEM1 DUF2947 Motif Other DBs NCBI-ProteinID:  EFX71170 JGI:  Dappu1_327432 UniProt:  E9HAR1 LinkDB All DBs Position Unknown AA seq 80 aa AA seqDB search MADVKIEKTDSTTEKPKVDLGLLEEDDEFEEFPADDWTGKEEDADDVNVWEDNWDDDNVE DDFSQQLRAALEKQGIKMEQ NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggcagatgtgaagatcgaaaaaactgactccaccaccgaaaagccaaaagtagattta ggtctgctcgaggaagacgatgaattcgaagagtttccggctgatgattggactggcaaa gaagaagatgctgacgatgtcaatgtctgggaagacaactgggatgatgacaacgttgaa gatgatttcagccagcaattgagggctgctctggagaaacaaggcattaaaatggaacag tga

DBGET integrated database retrieval system