Daphnia pulex (common water flea): DAPPUDRAFT_43804 Help Entry DAPPUDRAFT_43804  CDS       T04347                                  Name (GenBank) hypothetical protein   KO K11253   histone H3 Organism dpx  Daphnia pulex (common water flea) Brite KEGG Orthology (KO) [BR:dpx00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:dpx03036]     DAPPUDRAFT_43804   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dpx04147]     DAPPUDRAFT_43804 Chromosome and associated proteins [BR:dpx03036]  Eukaryotic type   Nucleosome assembly factors    Histones     DAPPUDRAFT_43804 Exosome [BR:dpx04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    DAPPUDRAFT_43804 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C CENP-S CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-ProteinID:  EFX86829 JGI:  Dappu1_43804 UniProt:  E9G035 LinkDB All DBs Position Unknown AA seq 72 aa AA seqDB search QLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKD IQLARRIRGERA NT seq 219 nt NT seq  +upstreamnt  +downstreamnt cagttgccattccagcgcttggtcagagaaatcgcccaggatttcaagaccgacttgcgt ttccagagctcggccgtcatggccctgcaggaggccagcgaggcttacttggtgggtctt ttcgaagacaccaacttgtgcgccatccacgccaagcgagtcaccatcatgccaaaagac atccagctcgctcgccgtattcgtggtgaacgtgcctaa

DBGET integrated database retrieval system