KEGG   Daphnia pulex (common water flea): DAPPUDRAFT_46010
Entry
DAPPUDRAFT_46010  CDS       T04347                                 
Name
(GenBank) phm, putative ecdysteroid 25-hydroxylase, ecdysone biosynthesis
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
dpx  Daphnia pulex (common water flea)
Pathway
dpx00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:dpx00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    DAPPUDRAFT_46010
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:dpx00199]
    DAPPUDRAFT_46010
Enzymes [BR:dpx01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     DAPPUDRAFT_46010
Cytochrome P450 [BR:dpx00199]
 Cytochrome P450, animal type
  CYP306 family
   DAPPUDRAFT_46010
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: EFX85499
JGI: Dappu1_46010
UniProt: E9G4T9
LinkDB
Position
Unknown
AA seq 530 aa
MEEGVLEEEEARSVGVWAWLSLSSLLLGLLALLWLRFHSQQRNRQLLLLLPPGPSGLPWL
GYLPWIDSRAPYETFAELSRRYGRIYSLKLGDMLAVFISDPQLVRQAFSRPVFSGRAPLY
LTHGIMKGHGLICAEGESWREHRRFVMNVMKQLGMAGRRGASVMESRVMAGVLEFVHCQV
TDGGVGGGVDLVPGLRHCIGNIINGVVFGRTYAADDPTWIWLQHLLDQGVKQVAVAGPIN
FLPVLRFLPSYRKIMSFILDGQAETHRHYQEIIDQRQLNLSANQGPDYTSVVEAYLLEMQ
RRQSAGIPPETFTTVQLHHVLADMFGAGTDTALTTIKWIVLYLILYPDVQERIHEEIERV
VGQLDQGRIPCYATDARRMPWTEATICEVQRLKTILPLGVPHGTLQDCELAGYRIPKGAM
VVPVWWAMNLDPTLWPEPLQFRPERFLEEEEEKWRVEKPEHFLPFQCGRRMCIGDDLGRT
LIFLFTVTLLQHFRLSFPPQFTDYSATNFPQPDYGFTLVPHPYPVALHPR
NT seq 1593 nt   +upstreamnt  +downstreamnt
atggaagaaggtgtattggaagaagaagaagcccgttctgtcggcgtttgggcctggctg
agcctgtcgagtcttctgctaggattattagcgttgctatggttacgcttccactcacaa
caacgcaatcgacagctgctgctgctgctgccgccgggaccgtccggtttgccttggctc
ggctacttgccgtggatcgacagccgggcgccttacgagacttttgccgagctgagtcgc
cgctacggccgcatttactcgctcaaactgggcgacatgttggccgttttcattagcgat
cctcaactggtccgccaggcttttagccggcccgttttctccggccgggctccgctctat
ctcacccacggcatcatgaaaggccacggattgatttgcgccgaaggcgagtcgtggcgg
gagcaccggcgcttcgtcatgaacgtcatgaaacaactgggcatggccggacgtagaggc
gcctctgtgatggagtcccgtgtcatggccggcgtcctggaatttgtccactgtcaggtg
acggacggtggcgtcggtggcggcgtcgatttggtgccgggattgcgtcactgcatcggc
aacatcatcaacggcgtcgttttcgggcggacgtacgcggccgacgatccgacctggatc
tggctccagcacctgctggaccaaggcgtcaaacaggtggccgtcgccgggcccatcaat
ttcctgcccgttctcaggttcttgcccagctatcggaaaatcatgtcgttcatccttgac
ggccaagccgagactcaccgccactaccaggagataatcgaccagcgccagctcaatctc
tccgccaatcaaggtccagattacaccagcgtcgtcgaggcctacctactggaaatgcaa
cgtcgtcaatcagccggaatcccgcccgaaaccttcacgactgtccagctgcaccacgtg
ctggccgacatgtttggtgccgggacggacacggcattgacgaccatcaagtggatcgtc
ctctacttgatcctctacccggacgtgcaagagcgaattcacgaggaaatcgagcgagtc
gtcggacaattggatcaaggaagaattccgtgctacgccacagatgcccggcggatgccg
tggacggaggccaccatctgcgaggtccagcgcctcaagaccatcctcccgctgggagtc
ccgcacggaacactacaagattgcgaattggccggttaccggatccctaaaggggccatg
gtcgtgcccgtctggtgggccatgaatctcgatccgaccttgtggccggaacctttacag
ttccgtccggagcgtttcctcgaagaagaagaagaaaaatggcgagtcgagaaaccggaa
catttcttgccgttccagtgcggacggcggatgtgcatcggcgacgatctcggacggact
ttgattttcctcttcaccgtgactctgctccaacatttccggctctccttcccgccgcaa
tttaccgattattccgcaacgaatttcccccaacccgactacgggttcacactcgtacct
catccgtacccagtggcactccatccgcgctaa

DBGET integrated database retrieval system