KEGG   Daphnia pulex (common water flea): DAPPUDRAFT_47869
Entry
DAPPUDRAFT_47869  CDS       T04347                                 
Name
(GenBank) hypothetical protein
  KO
K00411  ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:7.1.1.8]
Organism
dpx  Daphnia pulex (common water flea)
Pathway
dpx00190  Oxidative phosphorylation
dpx01100  Metabolic pathways
dpx04148  Efferocytosis
Module
dpx_M00151  Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:dpx00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    DAPPUDRAFT_47869
 09140 Cellular Processes
  09141 Transport and catabolism
   04148 Efferocytosis
    DAPPUDRAFT_47869
Enzymes [BR:dpx01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.8  quinol---cytochrome-c reductase
     DAPPUDRAFT_47869
SSDB
Motif
Pfam: Rieske UCR_Fe-S_N
Other DBs
NCBI-ProteinID: EFX83890
JGI: Dappu1_47869
UniProt: E9G9E2
LinkDB
Position
Unknown
AA seq 165 aa
MTTCAIGGVGAFGFLWPFLQSLAPAADVAALSTVDVDLSLIPEGQGMTVLWRGTPIFVRH
RTPQEIEEARKVALRDPAKDQDRVKPHKEAWLVVFGVCTHLGCVPVGQKPSQNRGDYGGW
FCPCHGSEYDTSGRVRRGPAPTNLPIPPYVFLDEKTLRIGEENHT
NT seq 498 nt   +upstreamnt  +downstreamnt
atgaccacgtgcgccattggaggcgtgggcgcctttgggtttttgtggccctttctccaa
agcctagcacctgctgcagacgtggcagccctgtcgacggtggatgtggatctttccctc
attcctgaaggccaaggcatgacggttttgtggcgtggaacgcctatttttgtgcgccac
cgaacccctcaagagattgaagaggcccgcaaagtagccctgagggatcctgcaaaagat
caagatcgggtgaagccccataaagaagcgtggcttgtggtttttggagtctgcacccat
ttgggatgcgtccctgtgggccagaaaccctcccaaaatcggggcgactatgggggatgg
ttttgcccttgccatggctctgaatacgatacctcaggacgtgtccgaagaggccccgct
cccactaatctgccgatccccccttatgtgtttttggacgaaaaaacactgcgcattggg
gaggaaaatcacacatga

DBGET integrated database retrieval system