Daphnia pulex (common water flea): DAPPUDRAFT_50367 Help Entry DAPPUDRAFT_50367  CDS       T04347                                  Name (GenBank) hypothetical protein   KO K11252   histone H2B Organism dpx  Daphnia pulex (common water flea) Brite KEGG Orthology (KO) [BR:dpx00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:dpx03036]     DAPPUDRAFT_50367   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dpx04147]     DAPPUDRAFT_50367 Chromosome and associated proteins [BR:dpx03036]  Eukaryotic type   Nucleosome assembly factors    Histones     DAPPUDRAFT_50367 Exosome [BR:dpx04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    DAPPUDRAFT_50367 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF Motif Other DBs NCBI-ProteinID:  EFX81287 JGI:  Dappu1_50367 UniProt:  E9GGX6 LinkDB All DBs Position Unknown AA seq 62 aa AA seqDB search MNVNDIYERIAGESSRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS TK NT seq 189 nt NT seq  +upstreamnt  +downstreamnt atgaacgtcaacgacatttacgagcgtatcgctggagagtcgtcccgtcttgcccactac aacaagcgttcgaccatcactagccgggaaatccagacggccgtccgtctgcttttgccc ggtgagttggccaagcacgccgtgtctgaaggcaccaaggcagtcaccaagtacaccagc accaagtaa

DBGET integrated database retrieval system