Daphnia pulex (common water flea): DAPPUDRAFT_52566 Help Entry DAPPUDRAFT_52566  CDS       T04347                                  Name (GenBank) hypothetical protein   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism dpx  Daphnia pulex (common water flea) Pathway dpx03010   Ribosome dpx04120   Ubiquitin mediated proteolysis dpx04137   Mitophagy - animal dpx04140   Autophagy - animal Brite KEGG Orthology (KO) [BR:dpx00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     DAPPUDRAFT_52566   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     DAPPUDRAFT_52566  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     DAPPUDRAFT_52566    04137 Mitophagy - animal     DAPPUDRAFT_52566  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:dpx03011]     DAPPUDRAFT_52566    04121 Ubiquitin system [BR:dpx04121]     DAPPUDRAFT_52566   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dpx04147]     DAPPUDRAFT_52566 Ribosome [BR:dpx03011]  Ribosomal proteins   Eukaryotes    Small subunit     DAPPUDRAFT_52566   Archaea     DAPPUDRAFT_52566 Ubiquitin system [BR:dpx04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    DAPPUDRAFT_52566 Exosome [BR:dpx04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    DAPPUDRAFT_52566   Exosomal proteins of colorectal cancer cells    DAPPUDRAFT_52566 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 Rad60-SLD_2 DUF2604 Dsc3_N TBK1_ULD Ubiquitin_5 OTU1_UBXL UBL_UBAC1 Motif Other DBs NCBI-ProteinID:  EFX79447 JGI:  Dappu1_52566 UniProt:  E9GM54 LinkDB All DBs Position Unknown AA seq 111 aa AA seqDB search MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN IQKESTLHLVLRLRGGAKKRKKKNYTTPKKNKHKHKKVKLAVLKYYKVIDS NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atgcagatcttcgttaaaaccctcacgggtaaaaccattaccctcgaagttgagccttct gacactatcgaaaatgtcaaagccaaaatccaggataaggaaggtattcctcctgatcag cagaggttgatcttcgccggcaagcagctggaagatggtcgcactttgtccgactacaac atccagaaggaatccaccttgcacttggtgctccgccttcgtggtggtgccaagaagcgc aagaagaagaactacaccactcccaagaagaacaagcataagcacaagaaagtcaagctc gctgttctcaagtactacaaggtaattgattcgtaa

DBGET integrated database retrieval system