Daphnia pulex (common water flea): DAPPUDRAFT_53356 Help Entry DAPPUDRAFT_53356  CDS       T04347                                  Name (GenBank) hypothetical protein   KO K08762   diazepam-binding inhibitor (GABA receptor modulator, acyl-CoA-binding protein) Organism dpx  Daphnia pulex (common water flea) Brite KEGG Orthology (KO) [BR:dpx00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dpx04052]     DAPPUDRAFT_53356 Cytokines and neuropeptides [BR:dpx04052]  Neuropeptides   Unclassified    DAPPUDRAFT_53356 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ACBP Motif Other DBs NCBI-ProteinID:  EFX78551 JGI:  Dappu1_53356 UniProt:  E9GPQ0 LinkDB All DBs Position Unknown AA seq 59 aa AA seqDB search MFLNLIISQKFNKAAEAIRNMTAAPSDDEMKEIYALYKQSTVGDVNTGEHCILTRLVFF NT seq 180 nt NT seq  +upstreamnt  +downstreamnt atgtttttgaatttgataatctcccagaaattcaacaaagctgccgaggccatcagaaac atgaccgccgctccctcagatgatgaaatgaaggagatttacgccttgtacaagcagtcc actgttggtgatgtcaataccggtgagcattgcatcttgactagactcgtttttttttaa

DBGET integrated database retrieval system