Daphnia pulex (common water flea): DAPPUDRAFT_54309 Help Entry DAPPUDRAFT_54309  CDS       T04347                                  Name (GenBank) hypothetical protein   KO K07953   GTP-binding protein SAR1 [EC:3.6.5.-] Organism dpx  Daphnia pulex (common water flea) Pathway dpx04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:dpx00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     DAPPUDRAFT_54309  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dpx04131]     DAPPUDRAFT_54309   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:dpx04031]     DAPPUDRAFT_54309 Membrane trafficking [BR:dpx04131]  Endoplasmic reticulum (ER) - Golgi transport   Forward pathways    Coat protein complex II (COP-II)     DAPPUDRAFT_54309 GTP-binding proteins [BR:dpx04031]  Small (monomeric) G-proteins   Arf/Sar Family    Sar     DAPPUDRAFT_54309 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Arf Motif Other DBs NCBI-ProteinID:  EFX77355 JGI:  Dappu1_54309 UniProt:  E9GT09 LinkDB All DBs Position Unknown AA seq 115 aa AA seqDB search RVCLDYLPDANCVVYIIDVSVPSRFTESKLELPILLSGDVLKECPFLIFGNKFDTNISCV PEGYIYFSNIIDPLLFIKEEMPIAPISRPVELFKCSIINRQGYEEDFCWLASHLR NT seq 348 nt NT seq  +upstreamnt  +downstreamnt cgagtttgccttgattatctccccgatgctaactgcgtcgtgtacataatcgatgttagt gttccaagtcgattcactgaaagcaaactagaacttccaatactcctgtcaggtgatgtg ttaaaggagtgtccattcttgatcttcgggaacaaatttgacacaaatattagttgtgta cctgaagggtatatatacttttcaaatattatcgatcctttactgtttattaaagaggag atgcccatcgctcctatttctcgtcctgtcgaacttttcaagtgttccatcatcaatcgt caaggatacgaagaggatttttgctggctcgccagccatctccggtga

DBGET integrated database retrieval system