Diaphorobacter nitroreducens: BA022_00600 Help Entry BA022_00600       CDS       T04937                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dpy  Diaphorobacter nitroreducens Pathway dpy01100   Metabolic pathways dpy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dpy00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BA022_00600    00074 Mycolic acid biosynthesis     BA022_00600   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BA022_00600 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 Phage_terminase Motif Other DBs NCBI-ProteinID:  ASI67208 LinkDB All DBs Position 132816..133055 Genome browser AA seq 79 aa AA seqDB search MSDIEARVKKIIAEQLGVEESQVTNEKAFVADLGADSLDTVELVMALEDEFGIEIPDEDA EKITTVQNAIDYANTHQKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgaagcacgtgtcaaaaaaatcattgccgaacaactcggcgtggaagag tcccaagtcaccaacgaaaaagccttcgtggcagatctgggtgccgactcgctggacacg gtggaactggtgatggcgctggaagacgagttcggcatcgagatccctgacgaagacgca gagaagatcacgacggtgcaaaacgccatcgactacgccaatacccaccagaaggcctaa

DBGET integrated database retrieval system