Daphnia pulicaria: 124340572 Help Entry 124340572         CDS       T08670                                  Name (RefSeq) elongin-C   KO K03872   elongin-C Organism dpz  Daphnia pulicaria Pathway dpz04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:dpz00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     124340572  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:dpz04121]     124340572    03400 DNA repair and recombination proteins [BR:dpz03400]     124340572 Ubiquitin system [BR:dpz04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      124340572    Cul5 complex      124340572 DNA repair and recombination proteins [BR:dpz03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      124340572 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ Motif Other DBs NCBI-GeneID:  124340572 NCBI-ProteinID:  XP_046649122 LinkDB All DBs Position 5:complement(6145577..6146498) Genome browser AA seq 114 aa AA seqDB search MSDGNENNSYGGCEGPNAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETN EVNFREIPSHVLQKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atgtcagatggaaatgaaaacaactcttatggtggttgtgagggaccaaatgctatgtat gtgaagttgatttcatctgatggccatgaatttattgtgaaacgggagcatgctcttact tcaggcactattaaggctatgttgtctggaccagggcagtttgctgaaaatgaaaccaat gaggtcaactttcgtgaaattccgtctcatgtcttgcagaaggtgtgcatgtattttaca tacaaggtgcgatacactaacagttccactgaaattcctgaatttcccattgctcctgaa attgcacttgaacttctgatggctgcaaacttcttggactgttaa

DBGET integrated database retrieval system