Dinoponera quadriceps: 106742160 Help Entry 106742160         CDS       T05610                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism dqu  Dinoponera quadriceps Pathway dqu04013   MAPK signaling pathway - fly dqu04145   Phagosome dqu04148   Efferocytosis dqu04310   Wnt signaling pathway dqu04620   Toll-like receptor signaling pathway dqu05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:dqu00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     106742160    04310 Wnt signaling pathway     106742160  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     106742160    04148 Efferocytosis     106742160  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     106742160  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     106742160  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dqu04131]     106742160   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dqu04147]     106742160    04031 GTP-binding proteins [BR:dqu04031]     106742160 Membrane trafficking [BR:dqu04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     106742160  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     106742160   Macropinocytosis    Ras GTPases     106742160  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     106742160 Exosome [BR:dqu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    106742160   Exosomal proteins of other body fluids (saliva and urine)    106742160   Exosomal proteins of colorectal cancer cells    106742160   Exosomal proteins of bladder cancer cells    106742160 GTP-binding proteins [BR:dqu04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     106742160 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU CagD Motif Other DBs NCBI-GeneID:  106742160 NCBI-ProteinID:  XP_014470331 UniProt:  A0A6P3WW59 LinkDB All DBs Position Unknown AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPATPIILVGTKLDLR EDKETIERLKDKKLAPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRAVLCPV LQVKPKRRCFLL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaagctatcaagtgcgtggtcgtcggcgacggagctgtaggtaaaacatgtttgctg ataagctacactaccaatgcatttcctggggagtacattccaacggtattcgacaattat tccgcgaatgtaatggtcgacgggaagccgattaatctcggcttgtgggatacagcggga caggaggattacgacagactacggccattgtcttatccacaaactgacgtttttctgatc tgcttctcgttggtaaacccggcgagttttgaaaatgtacgtgccaagtggtatcctgaa gtgcgtcaccattgtcctgccactccgattattttggttggcactaaactggacctgcgt gaagacaaggagactattgagcgtttaaaagacaagaaactcgctcccattacttatcct cagggtttggcgatggcgaaggagatcggtgccgtcaaatatttggaatgctcagctttg acacagaaaggcttgaaaactgtattcgatgaggcgatacgtgccgtactgtgccctgtt ctgcaagtgaagccaaagcgcagatgtttccttctataa

DBGET integrated database retrieval system