KEGG   Dinoponera quadriceps: 106747463
Entry
106747463         CDS       T05610                                 
Name
(RefSeq) cytochrome P450 306a1 isoform X1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
dqu  Dinoponera quadriceps
Pathway
dqu00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:dqu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    106747463
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:dqu00199]
    106747463
Enzymes [BR:dqu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     106747463
Cytochrome P450 [BR:dqu00199]
 Cytochrome P450, animal type
  CYP306 family
   106747463
SSDB
Motif
Pfam: p450 Rcd1
Other DBs
NCBI-GeneID: 106747463
NCBI-ProteinID: XP_014480494
UniProt: A0A6P3XPR1
LinkDB
Position
Unknown
AA seq 492 aa
MTSLIYVTLGISCFLIFIYTLRKNRKTFRLPPGPLGIPLLGYLPWLDPKNPHVSLTSLAR
KYGPLCGLRMGSVYTILLSDPRLIRQAFAKDAFAGRAPLYLTHGMMQGYGLICAEGDLWK
DQRRFVAGCLKNLGMVKFGTRRDKMEERILATVNECISKLRSRATVDGIDPLETLHHCMG
NLMNDLVFGKVYQEDDEVWRWLRHLQEEGVKHIGVAGPLNFLPFLRFLPRYGKVMESLID
GKLKSHRLYETIIDEHRARREKVDSFLAAFDEEMRNRTDAGNAGYFTRPQFYHLLADLFG
AGVDTTLTTLRWLLLFVAVHPDEQKKIQDEMSELLGQRQPGLTDRPALIRLEAAISEIQR
LRSVTPVGIPHGTTQDTQIGDYDVPKGTMVIPLQWAIHTDPSYWHEPLRFKPERFIAQDG
SIARPEAFLPFQAGKRMCVGDELARMILYLFAAKILRSFVISAPSDACIDLDGECGITLV
PKPHRLVFTSRE
NT seq 1479 nt   +upstreamnt  +downstreamnt
atgacatccctaatatacgtcactctcggtatttcatgcttcctaattttcatttatact
cttcgcaaaaatcgcaaaacctttcgcctccccccgggaccacttggcatccctctcctc
ggctatctaccgtggctagatcccaagaatccccacgtgtcgttgacgagtcttgcgagg
aaatacggaccgctttgtggactccgaatgggctcggtgtacacgatcctgttgtcggat
cctcggctgataagacaggcctttgctaaggacgcgtttgctggcagggctccactctat
ttgacgcacggaatgatgcagggatacggtctcatttgtgcggaaggtgatctctggaaa
gatcaaagaagattcgtagcaggatgcctaaagaatctcggcatggtaaagtttggcaca
aggagggacaagatggaagagaggattctcgcgaccgtgaacgaatgcatatcgaaacta
agaagtcgcgcgacggtcgacggtatcgacccactggagacgcttcatcactgcatgggt
aatttgatgaacgacctcgtcttcggcaaagtttaccaggaggatgacgaggtgtggagg
tggctgaggcacttgcaggaagaaggagtcaagcacatcggagtcgcagggccgctgaat
tttttgccgtttctcagatttttgccacgatacggcaaggtgatggagtcgctgatcgat
ggcaagctaaagtcacaccgtttgtacgaaacaatcatcgacgagcatcgtgcgcgacgt
gaaaaggtggacagctttctcgcggctttcgacgaggaaatgaggaacaggaccgacgcg
ggcaatgctggatacttcacgcgaccgcagttctatcatctgttggccgatcttttcggc
gccggcgtcgatactactctgactactcttcgttggctcctgctcttcgtggcggtgcat
ccagacgagcaaaaaaagattcaggatgagatgagcgaacttttgggacaaagacagccc
ggtttgacggatagacctgctttgattcgactggaggcggccatctcggagatacaaaga
ttgcgaagtgtcaccccggttgggattcctcacggtacaacgcaggacacacaaataggc
gactacgatgtaccaaaaggcacgatggtcatcccgttgcaatgggctattcatacggat
ccttcttactggcacgagccgctccgctttaaacccgagagatttatcgcgcaggatgga
agtatcgccaggccggaagccttcttgccttttcaagcgggcaaacgtatgtgcgtcggc
gacgaactggcccggatgatattgtacctgttcgctgcgaaaatacttcgctcgttcgtt
atctcggcaccgtccgacgcgtgcatcgatctcgacggcgaatgtgggatcaccctggtt
ccgaaaccgcatcggttggtttttacgtcgcgcgaataa

DBGET integrated database retrieval system