Deinococcus radiodurans: DR_2085 Help Entry DR_2085           CDS       T00025                                  Name (GenBank) glutaredoxin, putative   KO K18917   mycoredoxin [EC:1.20.4.3] Organism dra  Deinococcus radiodurans Brite KEGG Orthology (KO) [BR:dra00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     DR_2085 Enzymes [BR:dra01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      DR_2085 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Thioredoxin_2 Thioredoxin_9 GST_N Glrx-like Thioredoxin_3 IU_nuc_hydro Thioredoxin Motif Other DBs NCBI-ProteinID:  AAF11632 UniProt:  Q9RSN9 LinkDB All DBs Position 1:complement(2098437..2098682) Genome browser AA seq 81 aa AA seqDB search MVKMYTTTWCPDCHAAKRALTQKGIAYEEINIEQDEQAAEYVMSVNGGRRSVPTLVSGDV AHSLSGFRPQKLDAFLAEAGL NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggtcaaaatgtacaccaccacctggtgccccgactgccacgcggccaagcgggcgctg acgcagaagggcatcgcttacgaggaaatcaacatcgagcaggacgaacaggccgccgag tacgtgatgagcgtgaacggcgggcgccgcagcgtgcccaccctggtcagcggcgacgtg gcgcacagcctcagcgggttccggcctcagaagctcgacgcgtttctggcggaagcgggc ctctaa

DBGET integrated database retrieval system