Deinococcus radiophilus: LMT64_04035
Help
Entry
LMT64_04035 CDS
T07688
Name
(GenBank) ATP-dependent helicase
KO
K03657
ATP-dependent DNA helicase UvrD/PcrA [EC:
5.6.2.4
]
Organism
drd
Deinococcus radiophilus
Pathway
drd03420
Nucleotide excision repair
drd03430
Mismatch repair
Brite
KEGG Orthology (KO) [BR:
drd00001
]
09120 Genetic Information Processing
09124 Replication and repair
03420 Nucleotide excision repair
LMT64_04035
03430 Mismatch repair
LMT64_04035
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03400 DNA repair and recombination proteins [BR:
drd03400
]
LMT64_04035
Enzymes [BR:
drd01000
]
5. Isomerases
5.6 Isomerases altering macromolecular conformation
5.6.2 Enzymes altering nucleic acid conformation
5.6.2.4 DNA 3'-5' helicase
LMT64_04035
DNA repair and recombination proteins [BR:
drd03400
]
Prokaryotic type
SSBR (single strand breaks repair)
NER (nucleotide excision repair)
GGR (global genome repair) factors
LMT64_04035
MMR (mismatch excision repair)
Other MMR factors
LMT64_04035
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
UvrD-helicase
UvrD_C
AAA_19
PcrA_UvrD_tudor
UvrD_C_2
AAA_30
Viral_helicase1
AAA_11
AAA_12
CENP-K
Motif
Other DBs
NCBI-ProteinID:
UFA51074
LinkDB
All DBs
Position
771507..773753
Genome browser
AA seq
748 aa
AA seq
DB search
MVFVTLARVTPDAPTDLLAQLNEQQAAAADHYTGPALVIAGAGSGKTRTLIYRIAHLIAH
YGAEPGEILAVTFTNKAAAEMRERASRLVPGADRLWMSTFHSAGVRILRAYGEHIGLRRG
FVIYDDDDQLDILKQITGSMSGFGPDTNLRAVRGQIDRAKSNLVTPGQMLAGGEPYLAGL
PRELVAEAYSQYESRKKAQNAIDFGDLITETVRLFQEVPAVLDKVQNRARFIHVDEYQDT
NKAQYELTRLLASRDGNLLVVGDPDQSIYRFRGADIQNILDFQKDYPDAKVYRLESNYRS
SASVLTAANRLIEQNTERLEKTLKPVKEAGHPVVFHRANDHRGEGDFVADWLTRLHGEGR
DFADMAVLYRTNAQSRVVEESLRRVGIPARIVGGVGFYDRREIRDILAYARLALNPADDV
ALRRIISRPRRGIGDTSLTRLLDWAAQHGTSALEACARAEQDGILERGANKATEFADLMH
SMSEAADNYEPAQFLRFVMESSGYLDMLRQEGTEGQTRLENLEELISAAEEWSQDNHGTI
GDFLDDAALLSSVDDMRAQQENKGVPEDAVTLMTLHNAKGLEFPVVFIVGVEEGLLPSRN
SLNERGGVEEERRLFYVGITRAMERLFLTAAENRMQYGRTNSAEDSRFLEEIGTEFETWN
AFGQAVDYRQKSWKDFRPSAPAQPTVKNTSALTADLAYRGGEKVLHPKFGEGQVLAVAGM
GDKQEVTVHFPAVGAKKLLVKFANLKPA
NT seq
2247 nt
NT seq
+upstream
nt +downstream
nt
atggtttttgttacactggcccgcgtgactcctgacgcgcccaccgatcttctcgcgcag
ctcaacgaacagcaggccgccgccgcagatcactacaccggccctgcgctggtgattgcc
ggcgcgggcagtggcaagacccggaccctgatttaccggatcgcccatctgatcgcccat
tacggtgctgaaccgggcgagattctggcggtgacctttaccaacaaggcggctgccgag
atgcgtgagcgggccagccgcctggtgcctggagctgaccgcctctggatgagcaccttt
cactcggcgggagtacggattctgcgggcgtatggcgaacatatcggcctgcgccggggt
ttcgtgatttacgatgacgatgaccagctggacatcctgaagcagattaccgggtctatg
tcgggtttcgggccggataccaatctccgggcagtacggggccagattgaccgcgccaag
agcaatttggtcacaccagggcaaatgctggcgggcggcgaaccctacttggcgggcttg
ccacgtgaactggtcgcagaagcctacagtcagtatgagtcgcgcaagaaggcccagaat
gccattgattttggggacctgattaccgagacggttcggctgtttcaggaagttccagcc
gtgctggacaaggtgcaaaaccgcgcccgctttattcatgtggacgagtatcaggacacc
aacaaggcccagtacgaactgacccgtctgctggcctcgcgtgacggaaacctgctggtc
gtgggcgatccggatcagtccatctaccgctttcgtggggctgatattcagaacattctg
gactttcaaaaagattatccggacgccaaggtctatcggctggaaagcaactaccgctcc
agcgccagcgtgctgaccgctgccaatcgcctgattgagcagaataccgagcgccttgaa
aaaactctgaagcctgtgaaggaagcggggcatccagtggtgtttcaccgtgccaacgat
caccggggtgagggtgactttgtggccgattggctgacccggctgcacggcgaggggcgc
gactttgccgacatggcggtgctgtaccgtaccaatgctcagtcccgcgtggtcgaggaa
tcactgcggcgtgtgggcatcccggcccgcattgtgggaggtgtaggtttttatgatcgc
cgcgaaatccgcgacatcttggcgtatgcccggctggcgctaaacccggctgacgatgtg
gccctgcggcgtatcatcagtcgcccgcgccggggaattggggatacctcgctgacccgc
ttactggactgggcggcgcagcatggcacgtccgcgctggaagcctgtgcccgcgctgag
caggatggcatcctggaacgcggtgccaacaaagccaccgagtttgcagacctgatgcac
agcatgagcgaggcagccgacaactatgaaccagcccagtttttaaggttcgtgatggaa
agcagcggttacctcgacatgctgcgtcaggagggcactgaagggcaaacccgcctggaa
aacttggaagaactgatcagtgctgctgaggaatggtcgcaggacaatcacggcaccatt
ggcgactttttggatgacgccgcgctgctgtccagcgtggacgacatgcgggcgcagcag
gaaaacaaaggtgtacccgaagacgccgtgaccctgatgaccctgcacaatgccaaggga
ctggaatttccggtggtgtttattgtgggtgtagaagagggcctgcttcccagtcgtaac
tcgctgaacgagcgcggcggggtagaggaggaacgccgactcttttacgtgggtattacg
cgggcaatggagcgactgtttctcacggctgccgagaaccggatgcagtatggtcgcacc
aattcagctgaggacagccgttttctggaagagatcggcacggagttcgaaacttggaac
gccttcgggcaggccgtggactaccgccagaaaagctggaaggatttccgcccgtctgca
cctgcccaacctacggtcaagaacaccagtgctctgactgccgatctcgcctaccgcggc
ggtgagaaggtcctgcatcccaaatttggcgaaggccaggtgctggcggtagcgggcatg
ggggacaagcaggaagtgacggtgcattttccagcagttggagccaagaagctgctggtc
aagttcgccaacctgaagcctgcctga
DBGET
integrated database retrieval system