Deinococcus radiophilus: LMT64_07240 Help Entry LMT64_07240       CDS       T07688                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism drd  Deinococcus radiophilus Brite KEGG Orthology (KO) [BR:drd00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:drd03032]     LMT64_07240    03036 Chromosome and associated proteins [BR:drd03036]     LMT64_07240    03400 DNA repair and recombination proteins [BR:drd03400]     LMT64_07240 DNA replication proteins [BR:drd03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     LMT64_07240 Chromosome and associated proteins [BR:drd03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     LMT64_07240 DNA repair and recombination proteins [BR:drd03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       LMT64_07240 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 DUF937 HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  UFA49688 LinkDB All DBs Position complement(1426398..1426694) Genome browser AA seq 98 aa AA seqDB search MEDAMNKQKVAKAELAARISERTGLTRKQASDVVSAATGLMIGALRTGQTVGLPNLGTFS ISRTAERQGVRPGTTDRITIPAGKKVRFKISTGLKDKL NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atggaggacgctatgaacaaacaaaaagtcgccaaggccgaactggccgcacgtatcagt gagcgcactggtctgacccgcaagcaagcttctgacgtcgtttctgccgcaactggcttg atgatcggtgccttacggaccggacaaacggtgggtctgcccaatctgggcaccttcagc atttcgcggaccgccgagcgtcagggggtacgccccggcaccaccgaccgcatcaccatt cccgccgggaaaaaggtgcggttcaagatcagtacggggctgaaagacaaattgtaa

DBGET integrated database retrieval system