Deinococcus radiophilus: LMT64_08320 Help Entry LMT64_08320       CDS       T07688                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism drd  Deinococcus radiophilus Pathway drd01100   Metabolic pathways drd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:drd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LMT64_08320 (acpP)    00074 Mycolic acid biosynthesis     LMT64_08320 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LMT64_08320 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  UFA49887 LinkDB All DBs Position 1647380..1647610 Genome browser AA seq 76 aa AA seqDB search MAVFDDVKEVIVEKLGADADQVTPEARFVEDLGADSLEIVELVMGLEDKFGLTISDEDAE NIRTVQAAVDYVEQNQ NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggcagtatttgatgacgtaaaagaagtgatcgtagaaaaactgggcgccgacgcagac caggtgactcccgaagcccgcttcgtggaagacctgggcgctgacagcctggaaatcgtc gagctggtgatgggtctggaagacaaattcggcctgaccatcagcgacgaagacgccgag aacatccgcacggtgcaggccgctgtggactacgtcgagcagaaccagtaa

DBGET integrated database retrieval system