Diaphorobacter ruginosibacter: H9K76_11595 Help Entry H9K76_11595       CDS       T06813                                  Name (GenBank) MmoB/DmpM family protein   KO K16244   phenol/toluene 2-monooxygenase (NADH) P2/A2 [EC:1.14.13.244 1.14.13.243] Organism drg  Diaphorobacter ruginosibacter Pathway drg00361   Chlorocyclohexane and chlorobenzene degradation drg00362   Benzoate degradation drg00623   Toluene degradation drg01100   Metabolic pathways drg01120   Microbial metabolism in diverse environments drg01220   Degradation of aromatic compounds Module drg_M00548   Benzene degradation, benzene => catechol Brite KEGG Orthology (KO) [BR:drg00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     H9K76_11595    00361 Chlorocyclohexane and chlorobenzene degradation     H9K76_11595    00623 Toluene degradation     H9K76_11595 Enzymes [BR:drg01000]  1. Oxidoreductases   1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen    1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor     1.14.13.243  toluene 2-monooxygenase      H9K76_11595     1.14.13.244  phenol 2-monooxygenase (NADH)      H9K76_11595 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MmoB_DmpM DUF4537 Motif Other DBs NCBI-ProteinID:  QNN59361 UniProt:  A0A7G9RUT6 LinkDB All DBs Position 2582829..2583131 Genome browser AA seq 100 aa AA seqDB search MQADHTGTEATRSKVFIAFQDNEESRAVIEAVLADNTEATAAYAPGLVKIDCPGRLVIRR ESIEEITGQPYNLQQIQINLVTLSGHVNEDDDEFSLSWGR NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgcaagcagaccacaccggcaccgaagccactcgctccaaggtgttcattgcgttccag gacaacgaggaatcacgcgccgtgatcgaggccgtgctcgccgacaacaccgaggccacg gccgcctatgcaccggggctcgtgaagatcgactgccccgggcgcctcgtgatccgccgc gaaagcatcgaggagatcaccggccagccctacaacctgcagcaaatccagatcaacctg gtgacgctctcgggccacgtcaatgaagacgacgacgaattctcgctgagctggggccgc tga

DBGET integrated database retrieval system