Diaphorobacter ruginosibacter: H9K76_17495 Help Entry H9K76_17495       CDS       T06813                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism drg  Diaphorobacter ruginosibacter Pathway drg01100   Metabolic pathways drg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:drg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     H9K76_17495 (acpP)    00074 Mycolic acid biosynthesis     H9K76_17495 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     H9K76_17495 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 Phage_terminase Motif Other DBs NCBI-ProteinID:  QNN56328 UniProt:  A0A7G9RL53 LinkDB All DBs Position complement(3845019..3845258) Genome browser AA seq 79 aa AA seqDB search MSDIEARVKKIIAEQLGVEESQVTNEKAFVADLGADSLDTVELVMALEDEFGIEIPDEDA EKITTVQNAIDYANTHQKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgaagcacgtgtcaagaaaatcattgccgaacaactcggtgtggaagag tcccaagtgaccaacgaaaaggccttcgtggctgacctgggcgctgactccctggacacg gtcgaactggtgatggctctggaagatgagttcggcatcgagattcctgacgaagacgca gagaagatcaccacggtgcagaacgccatcgactacgccaacacccatcaaaaggcctga

DBGET integrated database retrieval system