Desmodus rotundus (common vampire bat): 112296719 Help Entry 112296719         CDS       T05907                                  Symbol CCL17 Name (RefSeq) C-C motif chemokine 17   KO K21083   C-C motif chemokine 17 Organism dro  Desmodus rotundus (common vampire bat) Pathway dro04060   Cytokine-cytokine receptor interaction dro04061   Viral protein interaction with cytokine and cytokine receptor dro04062   Chemokine signaling pathway dro04625   C-type lectin receptor signaling pathway dro04657   IL-17 signaling pathway Brite KEGG Orthology (KO) [BR:dro00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     112296719 (CCL17)    04061 Viral protein interaction with cytokine and cytokine receptor     112296719 (CCL17)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     112296719 (CCL17)    04657 IL-17 signaling pathway     112296719 (CCL17)    04062 Chemokine signaling pathway     112296719 (CCL17)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dro04052]     112296719 (CCL17) Cytokines and neuropeptides [BR:dro04052]  Cytokines   Chemokines    112296719 (CCL17) SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  112296719 NCBI-ProteinID:  XP_024407261 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MTPVKMLLLVTLLLGAALQDARAARGTNVGRECCLEYFKGTVPVSRVMTWYRTSDECPKN AIVFVTVQGRSICTNPEEARVKKTIKAIKHLRKITKSQDPSTQKP NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgaccccagtgaagatgctgctcctggtcaccctcctgctgggcgccgcgctgcaggac gcccgtgcagcccgagggaccaacgtgggcagggagtgctgcctggagtacttcaaaggg accgtccctgtcagtagggtgatgacgtggtaccggacctcggacgagtgtcccaagaat gccatcgtgtttgtcactgtccagggcaggtccatctgcacgaaccccgaggaagccagg gtgaagaagacaatcaaggccatcaaacacttgcgaaaaatcacgaagtcacaggacccc agcacccagaaaccctga

DBGET integrated database retrieval system