Desmodus rotundus (common vampire bat): 112296720 Help Entry 112296720         CDS       T05907                                  Symbol CCL22 Name (RefSeq) C-C motif chemokine 22   KO K21095   C-C motif chemokine 22 Organism dro  Desmodus rotundus (common vampire bat) Pathway dro04060   Cytokine-cytokine receptor interaction dro04061   Viral protein interaction with cytokine and cytokine receptor dro04062   Chemokine signaling pathway dro04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:dro00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     112296720 (CCL22)    04061 Viral protein interaction with cytokine and cytokine receptor     112296720 (CCL22)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     112296720 (CCL22)    04062 Chemokine signaling pathway     112296720 (CCL22)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dro04052]     112296720 (CCL22) Cytokines and neuropeptides [BR:dro04052]  Cytokines   Chemokines    112296720 (CCL22) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  112296720 NCBI-ProteinID:  XP_024407262 LinkDB All DBs Position Unknown AA seq 93 aa AA seqDB search MASLQTALLAALILLAMVLQATEAGPYGANVEDSICCRNYIRYPVPLRVIKSYYWTSNSC RRPGLVLLTIKDREICSDPGSPWVKKILQRLNF NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggccagcctacagactgcgctcctggctgccctgatccttctggctatggtgcttcaa gcaactgaggcaggcccttacggagccaacgtggaggacagcatctgctgccggaactac atccgttaccccgtgcctctgcgggtgataaagagttactactggacttcgaactcttgc cggagacctggcctagtcttgctaaccatcaaggaccgggagatctgctccgatcccgga tcaccctgggtgaagaagattctccagaggctgaacttttga

DBGET integrated database retrieval system