Desmodus rotundus (common vampire bat): 112297858 Help Entry 112297858         CDS       T05907                                  Symbol PPP3R1 Name (RefSeq) calcineurin subunit B type 1   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism dro  Desmodus rotundus (common vampire bat) Pathway dro04010   MAPK signaling pathway dro04020   Calcium signaling pathway dro04022   cGMP-PKG signaling pathway dro04114   Oocyte meiosis dro04218   Cellular senescence dro04310   Wnt signaling pathway dro04360   Axon guidance dro04370   VEGF signaling pathway dro04380   Osteoclast differentiation dro04625   C-type lectin receptor signaling pathway dro04650   Natural killer cell mediated cytotoxicity dro04658   Th1 and Th2 cell differentiation dro04659   Th17 cell differentiation dro04660   T cell receptor signaling pathway dro04662   B cell receptor signaling pathway dro04720   Long-term potentiation dro04724   Glutamatergic synapse dro04921   Oxytocin signaling pathway dro04922   Glucagon signaling pathway dro04924   Renin secretion dro05010   Alzheimer disease dro05014   Amyotrophic lateral sclerosis dro05020   Prion disease dro05022   Pathways of neurodegeneration - multiple diseases dro05031   Amphetamine addiction dro05152   Tuberculosis dro05163   Human cytomegalovirus infection dro05166   Human T-cell leukemia virus 1 infection dro05167   Kaposi sarcoma-associated herpesvirus infection dro05170   Human immunodeficiency virus 1 infection dro05235   PD-L1 expression and PD-1 checkpoint pathway in cancer dro05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:dro00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     112297858 (PPP3R1)    04310 Wnt signaling pathway     112297858 (PPP3R1)    04370 VEGF signaling pathway     112297858 (PPP3R1)    04020 Calcium signaling pathway     112297858 (PPP3R1)    04022 cGMP-PKG signaling pathway     112297858 (PPP3R1)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     112297858 (PPP3R1)    04218 Cellular senescence     112297858 (PPP3R1)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     112297858 (PPP3R1)    04650 Natural killer cell mediated cytotoxicity     112297858 (PPP3R1)    04660 T cell receptor signaling pathway     112297858 (PPP3R1)    04658 Th1 and Th2 cell differentiation     112297858 (PPP3R1)    04659 Th17 cell differentiation     112297858 (PPP3R1)    04662 B cell receptor signaling pathway     112297858 (PPP3R1)   09152 Endocrine system    04922 Glucagon signaling pathway     112297858 (PPP3R1)    04921 Oxytocin signaling pathway     112297858 (PPP3R1)    04924 Renin secretion     112297858 (PPP3R1)   09156 Nervous system    04724 Glutamatergic synapse     112297858 (PPP3R1)    04720 Long-term potentiation     112297858 (PPP3R1)   09158 Development and regeneration    04360 Axon guidance     112297858 (PPP3R1)    04380 Osteoclast differentiation     112297858 (PPP3R1)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     112297858 (PPP3R1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     112297858 (PPP3R1)    05170 Human immunodeficiency virus 1 infection     112297858 (PPP3R1)    05163 Human cytomegalovirus infection     112297858 (PPP3R1)    05167 Kaposi sarcoma-associated herpesvirus infection     112297858 (PPP3R1)   09171 Infectious disease: bacterial    05152 Tuberculosis     112297858 (PPP3R1)   09164 Neurodegenerative disease    05010 Alzheimer disease     112297858 (PPP3R1)    05014 Amyotrophic lateral sclerosis     112297858 (PPP3R1)    05020 Prion disease     112297858 (PPP3R1)    05022 Pathways of neurodegeneration - multiple diseases     112297858 (PPP3R1)   09165 Substance dependence    05031 Amphetamine addiction     112297858 (PPP3R1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     112297858 (PPP3R1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:dro01009]     112297858 (PPP3R1) Protein phosphatases and associated proteins [BR:dro01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      112297858 (PPP3R1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EH SPARC_Ca_bdg EF-hand_9 Motif Other DBs NCBI-GeneID:  112297858 NCBI-ProteinID:  XP_024408469 LinkDB All DBs Position Unknown AA seq 160 aa AA seqDB search MCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEV DFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQ QIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgtgctcacactttgatgctgatgaaattaaaaggctaggaaagagatttaagaagctt gatttggacaattctggttctttgagtgtggaagagttcatgtctctgccagagttacaa cagaaccctttagtacagcgagtaatagatatatttgacacggatgggaatggagaggta gactttaaagaatttattgagggagtctctcagttcagtgtcaaaggtgataaggagcag aagttgaggtttgccttccggatctatgacatggataaagatggctatatttccaatggg gaactcttccaggtgctgaagatgatggtggggaacaatctgaaagatacacagttacag caaattgtagacaaaaccataataaatgcagataaggatggagatggaagaatatccttt gaagaattctgtgctgttgtaggtggcctagatatccacaaaaagatggtggtagatgtg tga

DBGET integrated database retrieval system