Desmodus rotundus (common vampire bat): 112298324 Help Entry 112298324         CDS       T05907                                  Symbol ELOB Name (RefSeq) elongin-B   KO K03873   elongin-B Organism dro  Desmodus rotundus (common vampire bat) Pathway dro04066   HIF-1 signaling pathway dro04120   Ubiquitin mediated proteolysis dro05170   Human immunodeficiency virus 1 infection dro05200   Pathways in cancer dro05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:dro00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     112298324 (ELOB)  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     112298324 (ELOB)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112298324 (ELOB)   09162 Cancer: specific types    05211 Renal cell carcinoma     112298324 (ELOB)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     112298324 (ELOB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:dro04121]     112298324 (ELOB)    03400 DNA repair and recombination proteins [BR:dro03400]     112298324 (ELOB) Ubiquitin system [BR:dro04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      112298324 (ELOB)    Cul5 complex      112298324 (ELOB) DNA repair and recombination proteins [BR:dro03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      112298324 (ELOB) SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Motif Other DBs NCBI-GeneID:  112298324 NCBI-ProteinID:  XP_024409022 LinkDB All DBs Position Unknown AA seq 124 aa AA seqDB search MPARCPQDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDG KILGECGFTSQTARPQAPATVGLAFRADDAFEALRIEPFSSPPELPDVMKPQDSGSSANE QAVQ NT seq 375 nt NT seq  +upstreamnt  +downstreamnt atgccagcccgctgcccccaggacgtgttcctcatgatccggcgccacaagaccaccatc ttcacggacgccaaggagtcgagcaccgtgttcgagctgaagcgcatcgtcgagggcatc ctcaagcggccgccggacgagcagcggctatacaaggatgaccaacttctggacgacggc aagatactgggcgagtgtggcttcaccagtcaaacagctcggccacaggccccagccact gtgggactggccttccgggcagatgatgcatttgaggccctgcgcattgagcccttctcc agcccaccagagctgcctgatgtgatgaagccgcaggactcaggaagcagtgccaatgaa caagctgtgcagtga

DBGET integrated database retrieval system