Desmodus rotundus (common vampire bat): 112298732 Help Entry 112298732         CDS       T05907                                  Symbol GAST Name (RefSeq) gastrin   KO K13768   gastrin Organism dro  Desmodus rotundus (common vampire bat) Pathway dro04081   Hormone signaling dro04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:dro00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04081 Hormone signaling     112298732 (GAST)  09150 Organismal Systems   09154 Digestive system    04971 Gastric acid secretion     112298732 (GAST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dro04052]     112298732 (GAST) Cytokines and neuropeptides [BR:dro04052]  Neuropeptides   GPCR binding    112298732 (GAST) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Gastrin Motif Other DBs NCBI-GeneID:  112298732 NCBI-ProteinID:  XP_024409584 LinkDB All DBs Position Unknown AA seq 104 aa AA seqDB search MQRLCVCVFLLALALATFSEASWKLGSQLQDVRSGPGVHRGLDPHSLDRLGPASHHQRQL RFQGPPDMIADLSKKQGPWLEEEEEEYGWMDFGRRSAEDGDQHP NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgcagcgactgtgtgtgtgcgtgttcctcttggcactggctctggccaccttttccgaa gcttcttggaagcttggctcccagctgcaggatgtacggtccggtccaggtgtccatcgg ggcctggatccacattcgctggacaggctgggtccagcctctcaccaccaaaggcagctg aggttccagggtcccccagacatgatagcagacctgtccaagaagcaggggccgtggctg gaggaagaagaagaagagtatggatggatggactttggccgccgcagtgctgaggatggg gaccaacatccctag

DBGET integrated database retrieval system