Desmodus rotundus (common vampire bat): 112298838 Help Entry 112298838         CDS       T05907                                  Symbol CCL5 Name (RefSeq) C-C motif chemokine 5   KO K12499   C-C motif chemokine 5 Organism dro  Desmodus rotundus (common vampire bat) Pathway dro04060   Cytokine-cytokine receptor interaction dro04061   Viral protein interaction with cytokine and cytokine receptor dro04062   Chemokine signaling pathway dro04620   Toll-like receptor signaling pathway dro04621   NOD-like receptor signaling pathway dro04623   Cytosolic DNA-sensing pathway dro04668   TNF signaling pathway dro05020   Prion disease dro05142   Chagas disease dro05163   Human cytomegalovirus infection dro05164   Influenza A dro05168   Herpes simplex virus 1 infection dro05323   Rheumatoid arthritis dro05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:dro00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     112298838 (CCL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     112298838 (CCL5)    04061 Viral protein interaction with cytokine and cytokine receptor     112298838 (CCL5)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     112298838 (CCL5)    04621 NOD-like receptor signaling pathway     112298838 (CCL5)    04623 Cytosolic DNA-sensing pathway     112298838 (CCL5)    04062 Chemokine signaling pathway     112298838 (CCL5)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     112298838 (CCL5)    05168 Herpes simplex virus 1 infection     112298838 (CCL5)    05163 Human cytomegalovirus infection     112298838 (CCL5)   09174 Infectious disease: parasitic    05142 Chagas disease     112298838 (CCL5)   09163 Immune disease    05323 Rheumatoid arthritis     112298838 (CCL5)   09164 Neurodegenerative disease    05020 Prion disease     112298838 (CCL5)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     112298838 (CCL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dro04052]     112298838 (CCL5)    00536 Glycosaminoglycan binding proteins [BR:dro00536]     112298838 (CCL5) Cytokines and neuropeptides [BR:dro04052]  Cytokines   Chemokines    112298838 (CCL5) Glycosaminoglycan binding proteins [BR:dro00536]  Heparan sulfate / Heparin   Chemokines    112298838 (CCL5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  112298838 NCBI-ProteinID:  XP_024409726 LinkDB All DBs Position Unknown AA seq 91 aa AA seqDB search MEVPTAALAVLFAAAALCTPASASPYASDTTPCCFAYISRPVPRAHLQEYFYTSSKCSMP AVVLITRKKRQVCADPEKKWVRDYINTLEMS NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atggaggtccccactgcagccctggctgtcctctttgccgctgccgccttgtgcactcct gcatcggcctcgccatatgcctccgacaccactccctgctgctttgcctacatctcccgc ccggtgccccgggcccacctccaggagtatttctacaccagcagcaagtgttccatgccg gcagtcgtcctaatcaccagaaagaagcgccaggtgtgtgccgacccagagaagaaatgg gtgcgggactacatcaacactttggagatgagctag

DBGET integrated database retrieval system