Desmodus rotundus (common vampire bat): 112299615 Help Entry 112299615         CDS       T05907                                  Symbol CALML6 Name (RefSeq) calmodulin-like protein 6   KO K02183   calmodulin Organism dro  Desmodus rotundus (common vampire bat) Pathway dro04014   Ras signaling pathway dro04015   Rap1 signaling pathway dro04020   Calcium signaling pathway dro04022   cGMP-PKG signaling pathway dro04024   cAMP signaling pathway dro04070   Phosphatidylinositol signaling system dro04114   Oocyte meiosis dro04218   Cellular senescence dro04261   Adrenergic signaling in cardiomyocytes dro04270   Vascular smooth muscle contraction dro04371   Apelin signaling pathway dro04625   C-type lectin receptor signaling pathway dro04713   Circadian entrainment dro04720   Long-term potentiation dro04722   Neurotrophin signaling pathway dro04728   Dopaminergic synapse dro04740   Olfactory transduction dro04744   Phototransduction dro04750   Inflammatory mediator regulation of TRP channels dro04910   Insulin signaling pathway dro04912   GnRH signaling pathway dro04915   Estrogen signaling pathway dro04916   Melanogenesis dro04921   Oxytocin signaling pathway dro04922   Glucagon signaling pathway dro04924   Renin secretion dro04925   Aldosterone synthesis and secretion dro04970   Salivary secretion dro04971   Gastric acid secretion dro05010   Alzheimer disease dro05012   Parkinson disease dro05022   Pathways of neurodegeneration - multiple diseases dro05031   Amphetamine addiction dro05034   Alcoholism dro05133   Pertussis dro05152   Tuberculosis dro05163   Human cytomegalovirus infection dro05167   Kaposi sarcoma-associated herpesvirus infection dro05170   Human immunodeficiency virus 1 infection dro05200   Pathways in cancer dro05214   Glioma dro05417   Lipid and atherosclerosis dro05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:dro00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     112299615 (CALML6)    04015 Rap1 signaling pathway     112299615 (CALML6)    04371 Apelin signaling pathway     112299615 (CALML6)    04020 Calcium signaling pathway     112299615 (CALML6)    04070 Phosphatidylinositol signaling system     112299615 (CALML6)    04024 cAMP signaling pathway     112299615 (CALML6)    04022 cGMP-PKG signaling pathway     112299615 (CALML6)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     112299615 (CALML6)    04218 Cellular senescence     112299615 (CALML6)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     112299615 (CALML6)   09152 Endocrine system    04910 Insulin signaling pathway     112299615 (CALML6)    04922 Glucagon signaling pathway     112299615 (CALML6)    04912 GnRH signaling pathway     112299615 (CALML6)    04915 Estrogen signaling pathway     112299615 (CALML6)    04921 Oxytocin signaling pathway     112299615 (CALML6)    04916 Melanogenesis     112299615 (CALML6)    04924 Renin secretion     112299615 (CALML6)    04925 Aldosterone synthesis and secretion     112299615 (CALML6)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     112299615 (CALML6)    04270 Vascular smooth muscle contraction     112299615 (CALML6)   09154 Digestive system    04970 Salivary secretion     112299615 (CALML6)    04971 Gastric acid secretion     112299615 (CALML6)   09156 Nervous system    04728 Dopaminergic synapse     112299615 (CALML6)    04720 Long-term potentiation     112299615 (CALML6)    04722 Neurotrophin signaling pathway     112299615 (CALML6)   09157 Sensory system    04744 Phototransduction     112299615 (CALML6)    04740 Olfactory transduction     112299615 (CALML6)    04750 Inflammatory mediator regulation of TRP channels     112299615 (CALML6)   09159 Environmental adaptation    04713 Circadian entrainment     112299615 (CALML6)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112299615 (CALML6)   09162 Cancer: specific types    05214 Glioma     112299615 (CALML6)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     112299615 (CALML6)    05163 Human cytomegalovirus infection     112299615 (CALML6)    05167 Kaposi sarcoma-associated herpesvirus infection     112299615 (CALML6)   09171 Infectious disease: bacterial    05133 Pertussis     112299615 (CALML6)    05152 Tuberculosis     112299615 (CALML6)   09164 Neurodegenerative disease    05010 Alzheimer disease     112299615 (CALML6)    05012 Parkinson disease     112299615 (CALML6)    05022 Pathways of neurodegeneration - multiple diseases     112299615 (CALML6)   09165 Substance dependence    05031 Amphetamine addiction     112299615 (CALML6)    05034 Alcoholism     112299615 (CALML6)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     112299615 (CALML6)    05418 Fluid shear stress and atherosclerosis     112299615 (CALML6)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:dro01009]     112299615 (CALML6)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dro04131]     112299615 (CALML6)    03036 Chromosome and associated proteins [BR:dro03036]     112299615 (CALML6)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dro04147]     112299615 (CALML6) Protein phosphatases and associated proteins [BR:dro01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      112299615 (CALML6) Membrane trafficking [BR:dro04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     112299615 (CALML6) Chromosome and associated proteins [BR:dro03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      112299615 (CALML6) Exosome [BR:dro04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    112299615 (CALML6) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 AIF-1 EF-hand_9 EF-hand_5 EH EF_EFCAB10_C EFhand_Ca_insen Motif Other DBs NCBI-GeneID:  112299615 NCBI-ProteinID:  XP_024410658 LinkDB All DBs Position Unknown AA seq 161 aa AA seqDB search MRALLQTERLTAAQVTEYKGVFEMFDEEGNGEVKTAELERLMSLLGINPTKSELTSMAKD VDRDNKGFFNCDSFLALMGIYWEKAQNQEGELRAAFRVFDKEGKGYIDWDTLKYVLMNAG EPLNEVEAEQMMKEADKDGDGTIDYEEFVAMMTGESFKLVQ NT seq 486 nt NT seq  +upstreamnt  +downstreamnt atgagggccctgctgcagacggagcgcctgacggctgcgcaggtcacagagtacaagggg gtcttcgagatgtttgacgaggagggcaacggggaggtgaagacggccgagctggagagg ctcatgagcctgctgggcatcaaccccaccaagagcgagctgacctccatggccaaggac gtggaccgagacaacaaagggttcttcaactgtgacagcttcctggccctgatggggatt tactgggagaaggcccagaaccaggagggcgagctgcgggcagctttccgagtcttcgac aaggagggcaagggctacatcgactgggacacactcaagtatgtgctcatgaatgcaggt gagcccctcaatgaggtagaagcggagcagatgatgaaggaggcagacaaggatggggac gggaccatcgactacgaggagttcgtggccatgatgaccggagagtccttcaagctagtt cagtag

DBGET integrated database retrieval system