KEGG   Desmodus rotundus (common vampire bat): 112300656
Entry
112300656         CDS       T05907                                 
Symbol
NOL3
Name
(RefSeq) nucleolar protein 3
  KO
K28177  nucleolar protein 3
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112300656 (NOL3)
SSDB
Motif
Pfam: CARD Trypan_PARP TonB_N
Other DBs
NCBI-GeneID: 112300656
NCBI-ProteinID: XP_024411709
LinkDB
Position
Unknown
AA seq 221 aa
MGNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRR
LLLLVQSKGEAACQELLRCAQRTARAPDPAWDWQHVGTGYRERSYDPPCPGHWTPEAAGS
GTPCPGLPRASHCDEAGGPESSEEGQSGTLEEPQTELEAEAAEGAEPESELQMDPEPEAE
PEPEPEPEPEPEPEPELDPDPEPEPEPEPEPDCEGDESEDS
NT seq 666 nt   +upstreamnt  +downstreamnt
atgggcaacgcgcaggagagaccatcagagactatcgaccgggagcggaaacgcctggta
gagacgctgcaggcagactctgggctgttgctggatgcgctcctggcaaggggcgtgctc
accgggcctgagtacgaggcgttggatgcgctgccagatgccgagcgcagggtgcgccgc
ttgctgctgctagtgcagagcaagggcgaggccgcctgccaggagctgctgcgctgcgcc
cagcgaactgcacgcgcgcccgaccctgcctgggactggcagcacgtaggcactggatac
cgggaacgcagctacgaccctccatgcccaggccactggacacctgaggcagccggctca
gggaccccatgccctgggctgcccagagcttcacactgcgatgaggccgggggtccagag
agctccgaggaagggcagtccggaaccctcgaggagccccagacagagctagaagctgag
gctgctgaaggggcagagccggagtcggaactgcagatggatccggaaccagaggcagaa
ccagagcccgagcccgagcccgaaccggagcccgagcccgaaccggagctggacccggat
ccagagcccgagcccgagcccgagcccgagccagactgcgagggagatgaatctgaagat
tcctga

DBGET integrated database retrieval system