Desmodus rotundus (common vampire bat): 112300751 Help Entry 112300751         CDS       T05907                                  Name (RefSeq) ubiquitin-like   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism dro  Desmodus rotundus (common vampire bat) Pathway dro03010   Ribosome dro04120   Ubiquitin mediated proteolysis dro04137   Mitophagy - animal dro04140   Autophagy - animal dro05012   Parkinson disease dro05022   Pathways of neurodegeneration - multiple diseases dro05167   Kaposi sarcoma-associated herpesvirus infection dro05171   Coronavirus disease Brite KEGG Orthology (KO) [BR:dro00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     112300751   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     112300751  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     112300751    04137 Mitophagy - animal     112300751  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease     112300751    05167 Kaposi sarcoma-associated herpesvirus infection     112300751   09164 Neurodegenerative disease    05012 Parkinson disease     112300751    05022 Pathways of neurodegeneration - multiple diseases     112300751  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:dro03011]     112300751    04121 Ubiquitin system [BR:dro04121]     112300751   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dro04147]     112300751 Ribosome [BR:dro03011]  Ribosomal proteins   Eukaryotes    Small subunit     112300751   Archaea     112300751 Ubiquitin system [BR:dro04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    112300751 Exosome [BR:dro04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    112300751   Exosomal proteins of colorectal cancer cells    112300751 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Ribosomal_S27 Ubiquitin_2 Tfb2 Motif Other DBs NCBI-GeneID:  112300751 NCBI-ProteinID:  XP_024411851 LinkDB All DBs Position Unknown AA seq 144 aa AA seqDB search MQIFMKTLMGKTITLEVEPLDTIENAKAKTQDKEGIPLEQQRLIFAGKQPEDGRTLSDYN IQKEFTLHLVLRLRGGAKKRKKSYTTPKKNTHKGKKVKLAVLKYYKADENGQISRLRWEC PSDECGAGVLWPVTLPDNIVGNVV NT seq 435 nt NT seq  +upstreamnt  +downstreamnt atgcagattttcatgaaaacccttatggggaagaccattacgcttgaggttgaacccttg gatacaatagaaaatgcgaaggccaagacgcaggataaggaaggaattcctcttgaacag caaagactgatctttgctggcaagcaaccggaagatgggcgtactttgtctgactacaat attcaaaaggagttcactcttcatcttgtgttgagacttcgtggtggtgctaagaaaagg aagaagtcttacacaactcccaagaagaatacgcataagggaaagaaggttaagctggct gtcctgaaatactacaaagcggatgagaatggccaaatcagtcgccttcgttgggagtgc ccttcagatgagtgtggtgctggagttttatggccagtcactttgccagacaatattgtg ggaaatgtggtctga

DBGET integrated database retrieval system