Desmodus rotundus (common vampire bat): 112302174 Help Entry 112302174         CDS       T05907                                  Symbol GSTA1 Name (RefSeq) glutathione S-transferase A1   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism dro  Desmodus rotundus (common vampire bat) Pathway dro00480   Glutathione metabolism dro00980   Metabolism of xenobiotics by cytochrome P450 dro00982   Drug metabolism - cytochrome P450 dro00983   Drug metabolism - other enzymes dro01100   Metabolic pathways dro01524   Platinum drug resistance dro05200   Pathways in cancer dro05204   Chemical carcinogenesis - DNA adducts dro05207   Chemical carcinogenesis - receptor activation dro05208   Chemical carcinogenesis - reactive oxygen species dro05225   Hepatocellular carcinoma dro05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:dro00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     112302174 (GSTA1)   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     112302174 (GSTA1)    00982 Drug metabolism - cytochrome P450     112302174 (GSTA1)    00983 Drug metabolism - other enzymes     112302174 (GSTA1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112302174 (GSTA1)    05204 Chemical carcinogenesis - DNA adducts     112302174 (GSTA1)    05207 Chemical carcinogenesis - receptor activation     112302174 (GSTA1)    05208 Chemical carcinogenesis - reactive oxygen species     112302174 (GSTA1)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     112302174 (GSTA1)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     112302174 (GSTA1)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     112302174 (GSTA1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:dro02000]     112302174 (GSTA1) Enzymes [BR:dro01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      112302174 (GSTA1) Transporters [BR:dro02000]  Other transporters   Pores ion channels [TC:1]    112302174 (GSTA1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GST_C GST_C_3 GST_N GST_N_2 Motif Other DBs NCBI-GeneID:  112302174 NCBI-ProteinID:  XP_024413537 LinkDB All DBs Position Unknown AA seq 222 aa AA seqDB search MAGKPKLHYFNGRGRMEPIRWLLAAAGVEFEETFLEAPEDLLKLRNDGYLMFQQVPMVEI DGMKLVQTRAILNYIATKHNLYGKDIKERALIDMYSEGVADLYEMIMLFPLCPPDQKGAK MAQIKERTTNRYFPAFEKVLKSHGQDYLVGNRLSKADIHLVELIYTVEEIDPSLLANFPL LKALKTRISNLPTVKKFLQPGSQRKPPLDEKALEEARRIFKF NT seq 669 nt NT seq  +upstreamnt  +downstreamnt atggcggggaagcccaagcttcactacttcaatggacgaggccgaatggagcccatccgg tggctcctggctgcagcgggagtcgagtttgaagagacatttttggaagctccagaagac ttgctgaagttaaggaacgatgggtatctgatgttccagcaagtgccgatggtcgaaatc gatgggatgaagctggtgcagaccagagccatcctcaactacattgctaccaaacacaac ctctatgggaaagacataaaggagagagccctgattgatatgtattcagaaggtgtggca gatttgtacgagatgatcatgctttttccactgtgcccacctgatcaaaagggtgccaag atggcccagatcaaagagagaacaacaaatcgttatttccctgcctttgaaaaagtgctc aagagccatggacaagactacctggtaggcaacaggctgagcaaggctgacattcacctg gtggaacttatctacactgttgaagagattgaccccagccttctggccaacttccctctg ctgaaggccctgaaaaccaggattagcaacctccctacggtgaagaagtttctgcagcct ggcagtcagaggaagcctcccctagatgagaaagcgttagaagaagccaggaggattttc aagttttaa

DBGET integrated database retrieval system