Desmodus rotundus (common vampire bat): 112302356 Help Entry 112302356         CDS       T05907                                  Symbol CSNK2B Name (RefSeq) casein kinase II subunit beta   KO K03115   casein kinase II subunit beta Organism dro  Desmodus rotundus (common vampire bat) Pathway dro03008   Ribosome biogenesis in eukaryotes dro03083   Polycomb repressive complex dro04064   NF-kappa B signaling pathway dro04137   Mitophagy - animal dro04310   Wnt signaling pathway dro04520   Adherens junction dro05010   Alzheimer disease dro05020   Prion disease dro05022   Pathways of neurodegeneration - multiple diseases dro05162   Measles dro05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:dro00001]  09120 Genetic Information Processing   09122 Translation    03008 Ribosome biogenesis in eukaryotes     112302356 (CSNK2B)   09126 Chromosome    03083 Polycomb repressive complex     112302356 (CSNK2B)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     112302356 (CSNK2B)    04064 NF-kappa B signaling pathway     112302356 (CSNK2B)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     112302356 (CSNK2B)   09144 Cellular community - eukaryotes    04520 Adherens junction     112302356 (CSNK2B)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     112302356 (CSNK2B)   09172 Infectious disease: viral    05162 Measles     112302356 (CSNK2B)   09164 Neurodegenerative disease    05010 Alzheimer disease     112302356 (CSNK2B)    05020 Prion disease     112302356 (CSNK2B)    05022 Pathways of neurodegeneration - multiple diseases     112302356 (CSNK2B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03009 Ribosome biogenesis [BR:dro03009]     112302356 (CSNK2B)    03036 Chromosome and associated proteins [BR:dro03036]     112302356 (CSNK2B) Ribosome biogenesis [BR:dro03009]  Eukaryotic type   90S particles    Kinase     112302356 (CSNK2B) Chromosome and associated proteins [BR:dro03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.3/1.5)      112302356 (CSNK2B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CK_II_beta Motif Other DBs NCBI-GeneID:  112302356 NCBI-ProteinID:  XP_024413788 LinkDB All DBs Position Unknown AA seq 215 aa AA seqDB search MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDE ELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPML PIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDHAYLGTGFPHMLFMVHPEYRPKRPA NQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgagcagctcggaggaggtgtcctggatttcctggttctgtgggctccgtggcaatgaa ttcttctgtgaagtggatgaagactacatccaggacaagttcaacctcactggactcaat gagcaggtgcctcactatcgacaagctctagacatgatcttggacctggagcctgacgaa gagctggaagacaacccgaaccagagtgacctgattgagcaggcagctgagatgctgtat ggactgatccacgcccgctatatcctcaccaaccgtggcatcgcccagatgttggaaaaa taccagcagggagacttcggctactgtccgcgcgtgtactgtgagaaccagccaatgctt cccatcggcctttcggacatcccaggtgaggccatggtgaagctctactgccccaagtgc atggacgtgtacacacccaagtcgtcaaggcaccaccacacggaccacgcctacctcggc actggtttcccccacatgctgttcatggtgcaccccgagtaccggcccaagcggcccgcc aaccagtttgtgcccaggctctacggtttcaagatccacccgatggcctaccagctgcag ctccaagccgcaagcaacttcaagagcccagtcaagacgattcgctga

DBGET integrated database retrieval system