Desmodus rotundus (common vampire bat): 112304513 Help Entry 112304513         CDS       T05907                                  Symbol TXN Name (RefSeq) thioredoxin isoform X1   KO K03671   thioredoxin Organism dro  Desmodus rotundus (common vampire bat) Pathway dro04621   NOD-like receptor signaling pathway dro05012   Parkinson disease dro05132   Salmonella infection dro05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:dro00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     112304513 (TXN)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     112304513 (TXN)   09164 Neurodegenerative disease    05012 Parkinson disease     112304513 (TXN)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     112304513 (TXN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:dro03110]     112304513 (TXN) Chaperones and folding catalysts [BR:dro03110]  Protein folding catalysts   Protein disulfide isomerase    112304513 (TXN) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 OST3_OST6 DIM1 Thioredoxin_2 Thioredoxin_9 AhpC-TSA Thioredoxin_7 Glutaredoxin Redoxin Motif Other DBs NCBI-GeneID:  112304513 NCBI-ProteinID:  XP_024415907 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MVKQIESKEAFQEALNSAGDKLVVVDFSATWCGPCKMIKPFFHALSEKYTSVLFLEVDVD DCQDVASECEVKCMPTFQFFKKGKKVGEFSGANKEKLEATINELV NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtgaagcagattgagagtaaggaagctttccaggaagccttgaacagcgcaggagac aagcttgtggtggtggacttctccgccacgtggtgtgggccttgcaaaatgatcaagcct ttctttcacgccctctctgagaagtataccagtgtgctgttccttgaggtagatgtggac gactgtcaggatgttgcttcagagtgtgaagtcaaatgcatgccaaccttccagtttttt aaaaaaggaaaaaaggtgggtgaattttccggcgctaataaggaaaaacttgaagccacc atcaatgaattagtttaa

DBGET integrated database retrieval system