Desmodus rotundus (common vampire bat): 112304655 Help Entry 112304655         CDS       T05907                                  Symbol IL12A Name (RefSeq) interleukin-12 subunit alpha   KO K05406   interleukin 12A Organism dro  Desmodus rotundus (common vampire bat) Pathway dro04060   Cytokine-cytokine receptor interaction dro04620   Toll-like receptor signaling pathway dro04622   RIG-I-like receptor signaling pathway dro04625   C-type lectin receptor signaling pathway dro04630   JAK-STAT signaling pathway dro04658   Th1 and Th2 cell differentiation dro04936   Alcoholic liver disease dro04940   Type I diabetes mellitus dro05133   Pertussis dro05134   Legionellosis dro05140   Leishmaniasis dro05142   Chagas disease dro05143   African trypanosomiasis dro05144   Malaria dro05145   Toxoplasmosis dro05146   Amoebiasis dro05152   Tuberculosis dro05162   Measles dro05164   Influenza A dro05168   Herpes simplex virus 1 infection dro05171   Coronavirus disease - COVID-19 dro05200   Pathways in cancer dro05321   Inflammatory bowel disease dro05330   Allograft rejection dro05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:dro00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     112304655 (IL12A)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     112304655 (IL12A)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     112304655 (IL12A)    04622 RIG-I-like receptor signaling pathway     112304655 (IL12A)    04625 C-type lectin receptor signaling pathway     112304655 (IL12A)    04658 Th1 and Th2 cell differentiation     112304655 (IL12A)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112304655 (IL12A)   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     112304655 (IL12A)    05164 Influenza A     112304655 (IL12A)    05162 Measles     112304655 (IL12A)    05168 Herpes simplex virus 1 infection     112304655 (IL12A)   09171 Infectious disease: bacterial    05133 Pertussis     112304655 (IL12A)    05134 Legionellosis     112304655 (IL12A)    05152 Tuberculosis     112304655 (IL12A)   09174 Infectious disease: parasitic    05146 Amoebiasis     112304655 (IL12A)    05144 Malaria     112304655 (IL12A)    05145 Toxoplasmosis     112304655 (IL12A)    05140 Leishmaniasis     112304655 (IL12A)    05142 Chagas disease     112304655 (IL12A)    05143 African trypanosomiasis     112304655 (IL12A)   09163 Immune disease    05321 Inflammatory bowel disease     112304655 (IL12A)    05330 Allograft rejection     112304655 (IL12A)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     112304655 (IL12A)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     112304655 (IL12A)    04936 Alcoholic liver disease     112304655 (IL12A)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dro04052]     112304655 (IL12A)    00536 Glycosaminoglycan binding proteins [BR:dro00536]     112304655 (IL12A) Cytokines and neuropeptides [BR:dro04052]  Cytokines   Interleukins    112304655 (IL12A) Glycosaminoglycan binding proteins [BR:dro00536]  Heparan sulfate / Heparin   Cytokines    112304655 (IL12A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL12 Motif Other DBs NCBI-GeneID:  112304655 NCBI-ProteinID:  XP_024416062 LinkDB All DBs Position Unknown AA seq 219 aa AA seqDB search MRPPRSLLLVATLVLLHHLSLARNLPTTPAGPEPSQCLSHAQNLLVAVSNTLHKAMQTLE FYSCSSEEVDHKDITKDKTSTVEACLPQELTTDESCLVSREISFTTNGTCLASRKASFMM TLCLSSIYEDLKMYQVEFKAISAKLLMDPKRQITLDPNMLAAIDELMQVLKSNSETVPPK PSLGELDFYKTKIQLCVLLHAFRNRAVTIDRVMSYLSSS NT seq 660 nt NT seq  +upstreamnt  +downstreamnt atgcgcccaccacgcagcctcctccttgtggccaccctggtcctcctacaccacctcagt ttggccaggaacctccccaccaccccagcaggcccagaaccgtcccagtgcctcagtcac gcccagaacctgctggtggctgtcagcaacactctgcacaaggccatgcaaactctagaa ttttactcctgcagttctgaagaggtcgatcataaagatatcacaaaagataaaacgagc acagtagaggcctgcttaccccaagaattaaccacggatgagagttgcctggtttccaga gagatctctttcacaactaatgggacctgcctggcctccagaaaggcctcttttatgatg accctgtgccttagtagtatctatgaagacctgaagatgtaccaagtggagttcaaggct atcagtgcaaagctgttgatggatcctaagaggcagatcactctggatccaaacatgctg gcagctattgatgagctgatgcaggtcctgaagtccaacagtgagacggtgccacccaag ccctccctaggagaactggatttttacaagacaaaaatccagctctgcgtcctccttcat gctttcagaaaccgtgcagtgaccattgacagggtgatgagctatctgagctcttcctaa

DBGET integrated database retrieval system