Desmodus rotundus (common vampire bat): 112304835 Help Entry 112304835         CDS       T05907                                  Symbol CLDN11 Name (RefSeq) claudin-11   KO K06087   claudin Organism dro  Desmodus rotundus (common vampire bat) Pathway dro03272   Virion - Hepatitis viruses dro04382   Cornified envelope formation dro04514   Cell adhesion molecules dro04530   Tight junction dro04670   Leukocyte transendothelial migration dro05160   Hepatitis C Brite KEGG Orthology (KO) [BR:dro00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     112304835 (CLDN11)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     112304835 (CLDN11)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     112304835 (CLDN11)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     112304835 (CLDN11)   09158 Development and regeneration    04382 Cornified envelope formation     112304835 (CLDN11)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     112304835 (CLDN11)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:dro03037]     112304835 (CLDN11)    04147 Exosome [BR:dro04147]     112304835 (CLDN11)    04515 Cell adhesion molecules [BR:dro04515]     112304835 (CLDN11) Cilium and associated proteins [BR:dro03037]  Other cilia and associated proteins   Stereociliary proteins    112304835 (CLDN11) Exosome [BR:dro04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    112304835 (CLDN11)   Exosomal proteins of colorectal cancer cells    112304835 (CLDN11) Cell adhesion molecules [BR:dro04515]  Immunoglobulin superfamily   L1 family    112304835 (CLDN11) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 zf-LITAF-like Motif Other DBs NCBI-GeneID:  112304835 NCBI-ProteinID:  XP_024416283 LinkDB All DBs Position Unknown AA seq 208 aa AA seqDB search MMVATCLQVVGFVTSFVGWIGIIVTTSTNDWVVTCGYTIPTCRKLDELGSKGLWADCVMA TGLYHCKPLVDILILPGYVQACRALMIAASVLGLPAILLLLTVLPCIRMGQEPGVAKYRR AQLAGVMLILLALCAIVATIWFPVCAHRETTIVSFGYSLYAGWIGAVLCLVGGCVIVCCA GDAQSFGENRFYYSSGSSSPTHAKSAHV NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atgatggtggccacgtgtctgcaggtagtgggcttcgtcacgagcttcgtaggttggatc ggcatcatcgtcaccacgtccaccaatgactgggtggtgacttgcggctacactatccct acgtgccgcaagctggatgaactgggctccaaggggctgtgggctgactgcgtcatggcc acggggctgtaccactgcaagcccctggtggacatcctcatcctgccgggctacgtgcag gcctgccgagccctgatgattgcagcctcggtcctgggtctgccggccattctcctgctg ctgacggttctcccctgcatccgaatgggtcaggaacctggcgtggccaagtacaggcgg gcccagctggctggtgttatgctcattctgctggctctctgtgccattgtcgccaccatc tggttccctgtgtgcgcccaccgtgagaccaccatcgtgagctttggctactccctctat gcgggctggatcggagctgtgctctgcctcgtgggtggctgtgtcatcgtctgctgcgct ggagatgcccagtcgtttggggaaaaccgtttctactactcttcgggctccagctccccc actcatgccaagagtgctcatgtataa

DBGET integrated database retrieval system