Desmodus rotundus (common vampire bat): 112305484 Help Entry 112305484         CDS       T05907                                  Symbol SOD1 Name (RefSeq) superoxide dismutase [Cu-Zn]   KO K04565   superoxide dismutase, Cu-Zn family [EC:1.15.1.1] Organism dro  Desmodus rotundus (common vampire bat) Pathway dro04146   Peroxisome dro04213   Longevity regulating pathway - multiple species dro05012   Parkinson disease dro05014   Amyotrophic lateral sclerosis dro05016   Huntington disease dro05020   Prion disease dro05022   Pathways of neurodegeneration - multiple diseases dro05208   Chemical carcinogenesis - reactive oxygen species Brite KEGG Orthology (KO) [BR:dro00001]  09140 Cellular Processes   09141 Transport and catabolism    04146 Peroxisome     112305484 (SOD1)  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     112305484 (SOD1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     112305484 (SOD1)   09164 Neurodegenerative disease    05012 Parkinson disease     112305484 (SOD1)    05014 Amyotrophic lateral sclerosis     112305484 (SOD1)    05016 Huntington disease     112305484 (SOD1)    05020 Prion disease     112305484 (SOD1)    05022 Pathways of neurodegeneration - multiple diseases     112305484 (SOD1) Enzymes [BR:dro01000]  1. Oxidoreductases   1.15  Acting on superoxide as acceptor    1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)     1.15.1.1  superoxide dismutase      112305484 (SOD1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Sod_Cu Motif Other DBs NCBI-GeneID:  112305484 NCBI-ProteinID:  XP_024416985 LinkDB All DBs Position Unknown AA seq 153 aa AA seqDB search MTTRAVCVLKGDGPVQGTIRFEQEGTGPVKVFGTITGLTKGEHGFHVHEFGDNTQGCTSA GPHFNPLRKTHGGPQDEERHVGDLGNVTAEENGVAEVSLKDSQISLSGAHSIVGRTMVVH EKRDDLGRGGNDESKKTGNAGSRLACGVIGIAQ NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgacgaccagggctgtgtgcgtgctgaagggcgacggcccggtgcagggcaccatccgc ttcgagcaggagggtactggtcctgtcaaggtcttcgggaccatcaccgggctgaccaaa ggcgagcacgggttccatgtccacgagtttggagacaacacccaaggctgtaccagtgca ggtcctcactttaaccctctacgcaaaacccacggcggaccccaggatgaagagaggcac gtcggagacctgggcaacgtgaccgcggaggaaaacggtgtggcggaggtgtctctgaaa gactcccagatctccctctcgggagcccattccattgttggccgcacgatggtggtccac gaaaagcgggacgacctgggcagaggcggaaacgacgagagcaagaagaccggcaatgcc ggcagccggctggcctgcggggtgatcggcatcgcccagtga

DBGET integrated database retrieval system