Desmodus rotundus (common vampire bat): 112307621 Help Entry 112307621         CDS       T05907                                  Symbol DYNLT3 Name (RefSeq) dynein light chain Tctex-type 3   KO K10420   dynein light chain Tctex-type 1/3 Organism dro  Desmodus rotundus (common vampire bat) Pathway dro04814   Motor proteins dro05132   Salmonella infection Brite KEGG Orthology (KO) [BR:dro00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     112307621 (DYNLT3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     112307621 (DYNLT3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:dro03037]     112307621 (DYNLT3)    04812 Cytoskeleton proteins [BR:dro04812]     112307621 (DYNLT3) Cilium and associated proteins [BR:dro03037]  Motile cilia and associated proteins   Dynein arm    112307621 (DYNLT3) Cytoskeleton proteins [BR:dro04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      112307621 (DYNLT3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  112307621 NCBI-ProteinID:  XP_024419443 UniProt:  K9IGR0 LinkDB All DBs Position Unknown AA seq 116 aa AA seqDB search MEEYHRHCDEVGFNAEEAHNIVKECIDGVLGGEDYDHTNINQWTASIVEQSLAHLVKLGK AYKYIVTCAVVQRSAYGFHTANSCFWDTTSDGTCTVRWENRTMNCIVNVFAIAIVL NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggaggagtaccaccgccactgcgacgaggttggcttcaatgcagaggaagcccacaat attgttaaagagtgtatagatggggttttgggtggtgaagattatgaccataccaacatc aaccaatggactgcaagcatagtggaacaatccttagcacatttggttaagttgggaaaa gcttataaatatattgtgacctgtgcagtggtgcagaggagtgcttacggctttcacaca gccaattcctgcttttgggataccacatctgatggtacctgtaccgtaagatgggagaac cgaaccatgaactgcatcgtcaatgtttttgccattgctattgtcctgtga

DBGET integrated database retrieval system